SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL003084-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL003084-PA
Domain Number 1 Region: 116-168
Classification Level Classification E-value
Superfamily Orange domain-like 3.14e-16
Family Hairy Orange domain 0.00035
Further Details:      
 
Domain Number 2 Region: 51-109
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL003084-PA
Sequence length 284
Comment pep:novel scaffold:Hmel1:HE668657:37161:44976:1 gene:HMEL003084 transcript:HMEL003084-RA description:""
Sequence
MEYQRHMEPNNIQPQAQAQWGYGWGPPAPPAPAQRNKRTHSESEDDAFSEESSKDAQGVI
EKKRRDRINTSLTELKRLVPAACEKQGSAKLEKAEILQLTVDHLKMLHTKGLDTYAYDPQ
RYAMDYHSIGFRECAAEVARYLVSCEGLDIQDPLRLRLMSHLQCFAAQRELAAKSNWGYQ
YPSVPQPQHGYTELRQEPPVTTATSVAAPTAIAAPLSAPPSYAHYPPAPPAPPGPPAPPG
PHPGPHPAPTAPHYPAPYPHHPPHHQYSQNSSKPYRPWGAELAY
Download sequence
Identical sequences HMEL003084-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]