SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL003944-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL003944-PA
Domain Number 1 Region: 612-807
Classification Level Classification E-value
Superfamily Sec7 domain 5.76e-75
Family Sec7 domain 0.0000031
Further Details:      
 
Domain Number 2 Region: 89-160,377-557,833-887,1044-1445,1584-1635
Classification Level Classification E-value
Superfamily ARM repeat 1.85e-31
Family Plakophilin 1 helical region 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMEL003944-PA
Sequence length 1675
Comment pep:novel scaffold:Hmel1:HE669356:57786:65998:1 gene:HMEL003944 transcript:HMEL003944-RA description:""
Sequence
MQTNLKTKEMFIVRALEKILADKDIKRSYHSQLKKSCEVALEEIKAELKNGGQLEASESP
TSGTLPLPKNDSSNIITAEKYFLPFELACQSKASRIVVTALDCLQKLIAYGHLTGNIPDS
TTPRKLLIDRIVETICSCFNGPQTDEGVQLQIIKALLTVITSQHVEVHEGTVLLAVRTCY
NIYLASKNLINQTTARATLTQMLNVIFTKMENQALETESTPNPPPESHKIPNGNIPTEGT
QVNESSKEMTPNEEEIDEVLEAKIIAKQIVDSVIDNAISIASKKTATEMSLNGPENNENP
TDSQDSGSISQESNGQTNIDTTMTRIPSQESVDVASENDNSVTAKFTHVLQKDAFLVFRA
LCKLSMKPLPDGTPDPKSHELRSKILSLHLLLSILQNAGPVFRNNEMFITAIKQYLCVAL
SKNGVSSVPEVFELSLAIFLALLQNFKVHLKKQIEVFFKEIFMNILETSSSTFEHKWMVI
QALTRICGDAQSVVDIYVNYDCDLSAANLFQRLVNDVSKIAQGRQALELGATPNQEKSMR
IRGLECLVSILKCMVEWSKELYINPNMQTTLGERPVKEDTDRQSIKSHGGSSLSLVSTGS
SNIGNRETLDSPEQFEVLKQQKEVWETGIDLFNRKPKKGVTFLQEQGLLGTSTKEIAEWL
LTDERIDKIFIGEYLGENDDHSKEVMYAYVDSMNFSNMDIVAALRYFLEGFRLPGEAQKI
DRLMEKFAARYCECNPNNTLFTSADTVYVLAFSIIMLTTDLHSPQVKNKMTKEQYIKLNS
GISDNNDLPREYLSQIYDEIAGHEIKMKNTSKPGKHMISNEKKRKLIWNMEMEQISTAAK
NLMESVSHVQTQFTTAKHVEHVRPMFKMAWTPFLAAFSVGLQDCDDPEIASLCLDGIRCA
IRIACIFHMSLERDAYVQALARFTLLTANSPITEMKAKNIDTIKTLITVAHTDGNYLGSS
WLDVVKCISQLELAQLIGTGVRPQFLSGSGIKPQPDSLKFSLLALDPSVKEHIGETSSQS
VVVAVDRIFTGSTRLDGNAIVEFVKALCQVSLDELSHPTNPRMFSLQKIVEISYYNMGRI
RLQWSRIWQVLGDHFNKVGCSANEDIAFFAVDSLRQLSMKFIEKGEFANFKFQKDFLRPF
EHIMKKNSSPTIRDMVVRCIAQMVNSQAPNIKSGWKNIFSVFHLAASDQDEAIVDLAFQT
TGKIITELYEKQFSAMIDSFQDAVKCLSEFACNAKFPDTSMEAIRLVRSCATAVGTSPQL
FAEHAGLEGEPGAPEVDRVWLRGWFPLLFSLSCVVSRCKLDVRTRGLTVLFEIIKTHGDS
FRPHWWRDLFNILFRIFDIMKLPEHQLEKNEWMTTTCNHALYAIVDVFTQYFDILGSLLL
EQLYAQLHWCVQQDNEQLARSGTNCLENLVISNGTKFDEDTWSKTCQIMLDIFNSTLPTT
LLTWKPEENEDGETPQVRHGILKKPQGGDEIKSSNRVFNSLLIKCVVQLELIQTIDNIVF
YPATSRKEDAETLALAAAELTGGTPGTEQECQREEQGMYRLLSSPHLLRLVECLMCSHRF
AKTFNTNNAQRNVLWKANFKGSVKPNMLKQETQSLACVLRILFKMYSDEARRSHWPAVQK
SLITISCEALEYFGSLTNEAHRDAWTSILLLILTRILKMPDERVSILDFFSNIYE
Download sequence
Identical sequences HMEL003944-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]