SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL004147-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL004147-PA
Domain Number 1 Region: 78-126
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000353
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 50-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000301
Family Somatomedin B domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMEL004147-PA
Sequence length 187
Comment pep:novel scaffold:Hmel1:HE669488:104396:141443:-1 gene:HMEL004147 transcript:HMEL004147-RA description:""
Sequence
MKFWLYIVSAFSFGLCNANYCRDANLCCPGRDSSCVVQKAHQNAIIEDLTDKPCYCDHAC
LKLGDCCPDFRETCGVLDCVVSGWDDWSECDTTCGSGSMVRSRRIIQAPAHGGRHCPSLV
QRRACQAHHGCNSDSDVPLREESAMILPGGLSGSFDELTRNNKVLRPVRGDQGVKGLSHR
FRLQSSA
Download sequence
Identical sequences HMEL004147-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]