SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL007174-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL007174-PA
Domain Number 1 Region: 7-57
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000536
Family Insect pheromone/odorant-binding proteins 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL007174-PA
Sequence length 57
Comment pep:novel scaffold:Hmel1:HE670543:14467:14693:1 gene:HMEL007174 transcript:HMEL007174-RA description:""
Sequence
MYAHEKMSDIVAEQCLNEMYPKGRRIQFEESDEPCIIYCVLKKLGIMNSNGQINVDM
Download sequence
Identical sequences HMEL007174-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]