SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL010958-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL010958-PA
Domain Number 1 Region: 459-673
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.93e-37
Family Eukaryotic proteases 0.002
Further Details:      
 
Domain Number 2 Region: 79-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 121-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 24-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 5 Region: 154-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 6 Region: 213-282
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000989
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Weak hits

Sequence:  HMEL010958-PA
Domain Number - Region: 316-352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0659
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number - Region: 338-397
Classification Level Classification E-value
Superfamily Cupredoxins 0.0676
Family Multidomain cupredoxins 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMEL010958-PA
Sequence length 674
Comment pep:novel scaffold:Hmel1:HE671779:11307:23735:-1 gene:HMEL010958 transcript:HMEL010958-RA description:""
Sequence
MFFILFVLVGVSPLFSSSITVRRPNDYCSHDDFTCMDGGCVRFDKICDGIRDCLDGSDEA
ICSGVSYDDSWMNNRVKRQSTCLKNQWQCRDGTCIGFDGKCDGVVDCPDGSDETHPLCRK
IHGQFRCQNGQTIPASQHCDGAVDCSDGSDETIRACAARTCPSYVFQCAYGACVDQGSDC
DGKQDCADNSDESDELCNRISPVTTKPVVTPRPLPQGGKCVLPQYPKHGAYVVVGNPNTK
PGQTYPSVFINVTCNPGFGVENHRDSLYCFDGIWSEEMPKCVRFCRLYPNPSVEYRCLIS
GTNGVEGSRECGSLEAAGTVVRPECRAPNYYSGILPFMHCIDGNWDYIAVCKPGGNITIK
INDSVVIYVTNYDKNTNIEINAGKQNVSIEGNGLNVNIINVGNATNINSVQNNSKSNGSG
MFPYNPNGNVTNDDTGNGNASTNQDNSIYDIDEGDWRIAAHCFWSDVTKLQPASNYAVAA
GKLYRPWNNPRDSDAQKSDVAEIKIPSRFQGSAANFQDDIALVVVVTPFTYQVYIRPVCI
DFDVIFNRQQLHDGNMGKVAGWGLTEKNGVASQVLKVVDLPYVKIEDCIATSPPGFREYI
TSDKICAGYTNGTTLCQGDSGGGLAFAAQERGTQRYYLRGIVSTAPRNDDLCNANTLTTF
TQIANHDHFIKEFL
Download sequence
Identical sequences HMEL010958-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]