SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL012109-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL012109-PA
Domain Number 1 Region: 2156-2262
Classification Level Classification E-value
Superfamily Bromodomain 5.23e-34
Family Bromodomain 0.0000669
Further Details:      
 
Domain Number 2 Region: 2090-2145
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.32e-16
Family PHD domain 0.00053
Further Details:      
 
Domain Number 3 Region: 343-398
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000709
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 2049-2088
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000266
Family PHD domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL012109-PA
Sequence length 2267
Comment pep:novel scaffold:Hmel1:HE671258:60269:76780:1 gene:HMEL012109 transcript:HMEL012109-RA description:""
Sequence
MTGRGAKKRGRPPKSGSFEKNRKFQYHLLKKPKYLQTQNVGSSSLASTPSASRASSPQGS
DISRRSTRKQRGGKSHKSKRGGLSNAYSRRGYNPHAADYHESEYHYGSDFGDEFSDRSEP
EEDRGSDSSEGTARDAAASDSDFSISSYSSVGGTSRKTSNNLLRPPSPDPLWLQQERQIP
PLILPPSSDDLIIPHHLVLQIVGVYEVLRHFRHLVRLSPFRLEDLCAAVSCEDQSNLLIE
VHIMLLKALLREEDAQQTHFGPLDHKDSVNITLFLLDIMTWPEVLRIYVESDKSFDKNIG
RVLNSCEYPFTTIEDRLAVLQFLCNQFLITNPVRDDLISEAPIQYDDHCRVCHRLGDLLC
CETCPAVFHLECVDPPLVNVPSEDWQCALCKQHKTIGVTDCLPDAEKQGLLCRHEHLGFD
RHGRKYWFIARRIFVEAENSDVWYYTASHQFQDLLDVLDANEMEAPLVRELIEMKQEILR
QMNVTEDLTEQAKGNRKSYLEVEINNIIKRKVVKEEQRHIEPNNGIKLDDKDDSEMSIVH
ESDIVNEVTITSDEIVKDENDDIDCEDTKRTKNNCLLKTKSQNQKRSDDVTERVTRLKSN
QISNGTYLFKLGNENTFKSYINQYTNNPLALNKPQRNEERDKKRYISHKFSLSSGQEFKW
VGLLNATKPLFVATLRQTLLQLESNIVLQFMHPNWTLLRKPWAFKKHHLQVWKQKGEEYR
IHGQWGWLWNSATRRFKKHNSNVKLTISNGPAKIAVRVRDGNIIKVLAVEPKTYEYLTSN
ECTDQNVMQKLPVSMRNMKLEKETEDFEEIDVEKALSSSTRRYYPKIARKSKLDDFLARR
TYLKFMEEKKLGNILNNIKKEENVKNEEDKNVDIESEETETEIPSATVESNDINSKNVNI
GPKNIEILKEKYQMLTNLTKHYKCYSASCNNSDLSGVSSMKIECYSPLCIEKGKILQQLL
QLLKDGPNSCNSFLLASCKENNKISILEQYLLGKNSNSNENIVSDLLSAVACAQECDVKN
SDCFVKRKSSGDSDVNCKVENENNNSMCGIKSESTLEESAVPAVGNEMDIDITSNNNEDN
EVEIGPLKELTEHDQQNIESVDNKGRPPIPKLKITRGKSSKSNTNMNNGKGQDSSYECSL
KSEKASHKPKYRAVINRRFGLTRSVKKEDKIKEEKTDGVTRVYSTEIPNGKVYLKRVQTA
AVEKKKKRTPVKYPLCSSFHTKSKAKTIMVLPHHELKKLCRQAGHSTVSGFSHSCKPNQV
VWPYPCARPLFKTCWLYRTVNLPWLASAALQLRVMWACLRWDDMAAKPATADGKHQLTTD
TEIVSLELLKHRHIGQFSERTQYLRRKVVIPLELPKTIREVTSIRSGLRKRKRAESPQNT
EPQVTEEWVDEDKLELWEVRQYGERAERVTPVTRTSTGKLPQRNAAAPANASDLKDKMEQ
QLREQRAAHQQKRALEMSEKSKTTPNQVSGKSTLTSLLTTHTSTPTGQKNIIGTRRIIMT
KGADGTTRVINQSVSNNNKSILSSEVNKTPQKEGRQKVQIIRTPDGKFTVRGLLAGQQLI
QMPDVGDARAGAGAVRTAHCGAAGAADGGGFTAGGGASRHGRAPPADSARAGTAAARARA
PDTPGRAARLTLRPHRRAAPRPAATQQIVVNNPALVQQIAAGKIQLATVMQTSSGPSIVL
QGLHGYSLTPQQLALVQHQVKQQLLKAQESTGKQGMLGPRKMYLAVQPTPSAPPPLTPVA
PAPVPAPALHALPAPAQAHQTDALSEIFRVNLKCRYNLGITKSVIQAQWLAELVNFNQDS
ATEDKIKRLPLLNGEDHVSEAVSHKEAMPSKPEDIQGNNTKTDIVNSVNEGSQSNKFVLT
PDYIQQTIKSALKQENLNPEIEEKLLQLQRYQEKQMKPEALVEREVRVLPVRSPSPPTQR
RRGPSRHDDDDEWIEASPRKRARNARPPTPPSLAGTAPAGPALVAPAPVAPAVAPAAAPA
PAPAVPTSPAPTAPTTATTAPSARPASAHSRLLLFKYKEMLKKDIIKKRGLLEKELGVEI
QQIYVLLDYRFYVGCEHCSNWFHGDCVGVTEEMSKTMEEYVCSECRRAEETQELYCLCRQ
PYDNSQFYICCDRCQDWFHGRCVGILQSEADNIDEYICPNCQKNNSVNYANMKELTVKDF
ENLKRLIKQIQLHKNAWPFMEPVDPREAPTYYKVIKEPMDLQTVERKVNEQTYSMLSEFI
GDMTKIFDNCRYFNPKDSEFYRCADGLEAFFAQKIKYFREKLFESTQ
Download sequence
Identical sequences HMEL012109-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]