SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL012837-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL012837-PA
Domain Number 1 Region: 342-524
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.84e-43
Family CRAL/TRIO domain 0.0000787
Further Details:      
 
Domain Number 2 Region: 50-233
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.89e-43
Family CRAL/TRIO domain 0.0000494
Further Details:      
 
Domain Number 3 Region: 630-761
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.44e-23
Family CRAL/TRIO domain 0.00054
Further Details:      
 
Domain Number 4 Region: 876-991
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.31e-16
Family CRAL/TRIO domain 0.0013
Further Details:      
 
Domain Number 5 Region: 774-852
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000000288
Family CRAL/TRIO N-terminal domain 0.0069
Further Details:      
 
Domain Number 6 Region: 262-333
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000000484
Family CRAL/TRIO N-terminal domain 0.0079
Further Details:      
 
Domain Number 7 Region: 548-625
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000000863
Family CRAL/TRIO N-terminal domain 0.0079
Further Details:      
 
Domain Number 8 Region: 2-40
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000419
Family CRAL/TRIO N-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL012837-PA
Sequence length 1003
Comment pep:novel scaffold:Hmel1:HE671974:295328:322059:-1 gene:HMEL012837 transcript:HMEL012837-RA description:""
Sequence
MVLDDQWIVGFLRGCKYSLERTKEKLDLYYSMRGLAPELFSAKPSNPMSKEIMNIGVYFV
LPKSATPDAPRVAIIRPGVYDPDKYKINDIFSVSILIQRILMKEDDNVIVSGMRTILDLE
GVTVAHYLQMTPAVMKRMAVLSQDASPMRMKGTHYINTPPGFETVFNTMKLLLNEKNRNR
LYVHNKNYEEMYQSICKEELPVEYGGNGGTVNEIIEYWKNKIDHYSSWIEEDSKYGTDEA
KRPGSPKYREMPVRPLTPALAEKARLELNEDPKKLEEYIRHLKQWIQKQPHLRARTDDQW
LAAFIRGCKFRLDQSKSKLDLYFSYRSKAPYLYGVKYFEPKVMDILNLGAILMLRKTQSP
DGPRILLYRIGQYDPKDYAIVDLMSVLTLQQQISYMEDDNLVVAGTISVIDFAGTRLGHY
TQTSIKHLRNLISANQEAVPIRIKAVHFLNTPSFFGTFFNIGKAFLNEKVKNRIMVHGKN
IESLYEHVSKDVLPEEYGGTGESIQECIDYWKTKMRDYSSFYEDDLKYGSDESKRSISMI
RELPKELAKIAKNELNENPKQTEADLKNLKEWILKQPHLKARTEDQWLVALLRGCKFSLE
RVKAKVELFYTLRSVAPEMTLRLKPTEKEYLNFLRLGTCIILPQSKTDLQPCAILIRPGL
YDPSEYSIADVMCILYYLVQILVIENDVATVMGTKIIVDYQNVTLNHLTQASPSMLKKLV
TVSQDSLPLRLKGSHHVNVPSGIEVIFKLISGFLNEKAKERSTTMIRPLPPALQEIAEKE
LNEKPDRIEADILALREWLAKQPHLQAVKPSDQLLIAFLRGNKHSLERSKEKLDMFYTLR
SVVPEIYNHRNPFDPALQEFLKLGILLPIRREGFGTIVLTRFALFDPSQHKLVDFIKLVF
MTMEILMLEDDSYLICGEVRYHHALTDMDGVGIGIFLQWTPALAKKTVLSVEKSLPLRLK
DNYILVPQASSAFEAAFNLVKTLLSEKLKKRKEIDFYQLNIHK
Download sequence
Identical sequences HMEL012837-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]