SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL013253-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL013253-PA
Domain Number 1 Region: 332-613
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.33e-47
Family Eukaryotic proteases 0.00091
Further Details:      
 
Domain Number 2 Region: 19-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 141-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 206-273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000292
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 59-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 6 Region: 111-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  HMEL013253-PA
Domain Number - Region: 301-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00111
Family Complement control module/SCR domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL013253-PA
Sequence length 618
Comment pep:novel scaffold:Hmel1:HE671337:413742:420839:1 gene:HMEL013253 transcript:HMEL013253-RA description:""
Sequence
MHIRSSGPKGRHNVGKKCNVYFYRYWKNEFMCGDGTCITVERKCDGILDCPDGTDETYYL
CRDNRCPDYLFRCTYGGCVDRTALCNSVSDCADSSDEFHIKCRNESNIIGSQFKCDDGSL
IEQYLQCDGTIHCRDGSDENLMACSSFTCPANYFQCAYGACIDEAAECNNIKECADGSDE
HELLCGNSKTSSPTPVVESPQNENICKLPPHPENGMYLKNGASSTYNPGDVVDPVYLNVT
CRPGYKVVGSKLIICYKGFWSPDAFPTCARACKIEESLSVSYRCLITEEGSEGTRECEDM
EVESTVVVPSCKAPNYYSPVDLPYMYCVDGTWSQIPKCQPECGTLTPRGEALIAGGRVAE
RGEVPWHVGVYRRHKRSKHEQICGGSLISENIAISAAHCFWREGYGKLPEHLFSLAVGKR
YREWNHPNDNLLAQKSDVERIILPLRFKGLDMNYQSDLAIIIAKRPFEYRPHVRPLCVDF
TRPFYENNMRRGDVGKVPGFGLTNDHKGSESPILKVVDMPFVPFEECLRRTQREFVEFIT
NDKFCAGYGNGTTVCPGDSGGSWAYPVEMMNGRIRYYLGGIVSASPDSDDGSQCNMHALT
SFTDVYKFSKLIKTYWIP
Download sequence
Identical sequences HMEL013253-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]