SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL015026-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL015026-PA
Domain Number 1 Region: 580-784,837-1095
Classification Level Classification E-value
Superfamily Ras GEF 1.05e-116
Family Ras GEF 0.00000000071
Further Details:      
 
Domain Number 2 Region: 22-172
Classification Level Classification E-value
Superfamily Histone-fold 8.38e-31
Family TBP-associated factors, TAFs 0.0000396
Further Details:      
 
Domain Number 3 Region: 216-388
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-23
Family DBL homology domain (DH-domain) 0.0000285
Further Details:      
 
Domain Number 4 Region: 425-586
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-20
Family Pleckstrin-homology domain (PH domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL015026-PA
Sequence length 1473
Comment pep:novel scaffold:Hmel1:HE671493:52836:73865:-1 gene:HMEL015026 transcript:HMEL015026-RA description:""
Sequence
METEINNNVVHAGEAAGGPLILQNVHPTLNAEQSALEFVESLCLRLLAMLCAVPSPLTVQ
DVEERVARTFPTPLDRWALVDARDACTARRRRALHLPLDKLHQMLQKEVLLYKIDTSVSL
CMTAILEYVSSDIFRLAGNFVKQIPQKSGYHVITCSDIKTAMCADKVLMDMFYQESELTG
PVSTEGVSSGGTSGGTSGGTVGTSGGGGRRASLSYGELVRDLLADVRTFLRDLNLIIRVF
KDELEKILHGDSRSITLIFGNIVDIYELTVTLLGNLEDAMEMSQDSPTPYIGSCFEELAE
VEEFRAYVRYANIVTRKESRDALQNIVDDPLLSERLDTAGHGFRLAVKYCLPRLLLAPVG
HALLHHSYVCELLRAAPASDDRESFKQVECNLLLIKNLIMKTLGNGPKLEGAVRAAARAR
RQLAIEKCGELARLVDNWDARDVPQCCNEFIREDTLSKIGPGKRIAERRAFLFDGLLLLC
KPITGLVTVNSGATAGGPQQLKMKEKLHIRKLEIVDRGDGEEGRNLMELCPRVGPPVLLS
AASCAEKRHWMCDLVMLNTKPMLDRSLDSILLDLERRHPLRLPPATLYRFAEPDSSDNIV
LEDRPGTAPLIKGATLLKLVERLTYHVHADLNLVRTFLTTYRSFCAPADLLALLVERFDI
PEPHLVYDCQVPRNESVEISVSSDAEKLSKNTAREDWKRYRKEFLQPVKFRVINVLRHWV
DQHFYDFEREPALLENLKNFLESVDGKPMKKWVQSVLKTVQRKCAQSNQGLDGESVSGSL
ASIPGSIAGSILSMSTIGGPVTCGPGTMACAPGVAHVFDRSPPAPLRHVANPERHGWHPL
ALHPLELARQLTLLEFQLYRQVKPSELVGAVWTKKDKEKTSPNLLRIIKHTTNFTRWMEK
WIVESDNFEERVAVICRLIQLAIALHELNNFNGVLAAASAFSSAAVHRLRATWSAIPPRL
SRELSALKDLSADHFRRYQERLRSINPPCVPFLGIYLTNILHIEEGNLDYLQNSNLINFS
KRRKVAEITGEIQQYQNQPYCLTVEPRTRAFLESLDPFPAMSDKDVTDYLYETSLEIEPR
VVKQMPKFPRRYPELSLKSLKVPRRLHDAHGSATSVATVTSDDTISVAQLSPTSAWDGAS
VVSLPVHDHGGSLTSPRLERSCSSSLAQLGQLGQLSLFDKGLALFDKSKSVATLNRNSGS
TRDEPPSPRDNHSPSGRREHRAALSPRNAIVDAELFYSRSVDHLPPARRPPPPTQERVPP
LLPRAACTNNSEAPLPPRRPASPPPSDPPPTPPSPPDRPDRPPDRPPDRPPDRPPDRLQD
NRIPPERPPPSPKHHELFRSPAMSPKRSPAPAPPISPLDRAAFSFPSSTSPSAHHNSEGS
APPPLPPRRRRDSAAPHTPHLSSWSEHSAGASPSGSSPAPPAALTPPPLPPRPPPPPELK
GPAHSTLLQRRHTAALAPKLPPKPAATAVAPRT
Download sequence
Identical sequences HMEL015026-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]