SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL016235-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL016235-PA
Domain Number 1 Region: 357-676
Classification Level Classification E-value
Superfamily L domain-like 2.72e-46
Family Ngr ectodomain-like 0.09
Further Details:      
 
Domain Number 2 Region: 64-398
Classification Level Classification E-value
Superfamily L domain-like 5.36e-46
Family Internalin LRR domain 0.078
Further Details:      
 
Domain Number 3 Region: 753-939
Classification Level Classification E-value
Superfamily L domain-like 9.64e-30
Family Ngr ectodomain-like 0.013
Further Details:      
 
Domain Number 4 Region: 1016-1169
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-26
Family Toll/Interleukin receptor TIR domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL016235-PA
Sequence length 1296
Comment pep:novel scaffold:Hmel1:HE672071:16211:20101:-1 gene:HMEL016235 transcript:HMEL016235-RA description:""
Sequence
MYAVTAVLCALLHVGWTVSPYSSDKCVRVNDRDSESSVICKVRTLDGDGSSISSVRPETS
RLTIECNHLLLFESSLRAHYFSPVMGLTDLNIENCKLLTLTDYIFQDLNKLRRLKLRSKN
SEWSPTKNLELTLNSFNGLSELQSLDLAQNNIKFVPSRVFCSLENLNTLNLTQNRIRTVG
QIGFGHACGSSLHTLDLSHNEIKRLPEDSELLKLRSLQHLYLQHNNITDISSEAFNGLVS
LRVLNISHNRLHTLPEGIFAYSRELREIYLNDNSLFELAGGIFHRLEQLIVLDLSSNQLT
SSHVDDGTFLGLIRLIVLNLSNNALTRLDGKTFKDLFVLQILNLKNNSIGYIEDNAFLPL
YNLHTLNLAENRLLTIDENLFNGLFVLSKLTLNNNLLVNVDRKAFKNCSDVKELDLSSNQ
LLEVPDALWELPFLKTLDLGENQISTFTNGSFKNLNQLTGLRLIDNQIGNLSVGMFWDLP
SLQVLNIAKNKIHLIERGTFSRNAQLEAIRLDGNFLTDINGVFSTLASLLWLNLSENHLV
WFDYAFVPSNLKWLDIHGNFIEHLGNYYKLQDQIHIKTLDVSHNRIMEISPLAIPNSVEL
LFINNNFLNNIHVNTFFDKKNLTRVDMYANEIVHLELNSLRLSNVPANKSLPEFYIGGNP
FQCDCNMEWLPIINNMTAMRQYPRVMDLENVLCKMTNTRSGTHVPLTNLRTSDFLCEYET
HCFAICHCCDYDACDCEMTCPQNCTCYHDPLWNTNVVDCSGQSSMEIPHKIPMDATEVFL
DGNNIRELQNHVFIGRQKMRSLYVNNSNVDNIQNRTFAGLNNLQILHLGNNKLKELKGYE
FHQLGNLKELFLQNNLISHIANMTFMSLRSLHTLRLDGNRLVDFGVWSFNNNPNLKALSL
GNNLWSCKCRYLQELTAYLAENAQKIIDITDMWCWNGDAKPPQKKELNLNGTACSDYYAD
NSVIGNMLVSNYVPMMVLTLTGFMLILLALVVLFLFRDSLRVWLYTNCGIRVFSFSEAYE
ESEKLYDAYVCYSPKDEEFVIQSLANELEGGNRPYHLCLHYRDIPHHGAQYMQCAPPVAE
AAEASKKIILVLTRNFMQTEWSRYEFRQGLHEVLKGCIHKLIFIEECSVVGDAICDPDLR
PYLETRSRLRWGQKRFWERLRYIMPDTSHPSHKTRSHNYRKNINTYTLDSSVPNGGNRTM
SYLDKSPVLGNTGQGASAPPEYSTEVRQSPSAVRQTQAVAYGPDGRPISDHIYSSIDSDY
SSLEQGMAPGRRRDMRQWSTPPPLVDTGNSVQAYLV
Download sequence
Identical sequences HMEL016235-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]