SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL017479-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL017479-PA
Domain Number 1 Region: 339-662
Classification Level Classification E-value
Superfamily L domain-like 2.62e-50
Family Ngr ectodomain-like 0.083
Further Details:      
 
Domain Number 2 Region: 50-358
Classification Level Classification E-value
Superfamily L domain-like 3.11e-45
Family Ngr ectodomain-like 0.0056
Further Details:      
 
Domain Number 3 Region: 998-1141
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-29
Family Toll/Interleukin receptor TIR domain 0.00029
Further Details:      
 
Domain Number 4 Region: 705-932
Classification Level Classification E-value
Superfamily L domain-like 4.42e-27
Family Ngr ectodomain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL017479-PA
Sequence length 1229
Comment pep:novel scaffold:Hmel1:HE671623:77531:81220:-1 gene:HMEL017479 transcript:HMEL017479-RA description:""
Sequence
MGAAPSGAPDGCSRAADSGLECNVRALSSDRDVLGSTHSDGAERLAVRCGSHLLESTLKD
HYFGKMHGLTEITITDCKILRLPGNTFEGLRGLKTLKLRSMNSQWGHNKELELSLGAFNG
LRELHTLDLAYNNIRKIPSDLFCALENIISLNLTRNKIKFVDELGFGHKCGSTLQTIDLS
YNDIMSLPADSEILHLRRLTQLFLQSNKISELPGEVFGDLLSLKVVNLSENAINYLPESL
FQNTREIREIYLSYNELEILPKKLFNRLEQLVVLDLSANKLKGDHIEDETFGGLIRLIVL
DLSHNAFAGVKQNMFKDLFFLQILNLSNNSIGFIEDNAFSPLFNLHTLNLESNKLRTIED
HVFNGLFILNKLNLNNNILSYIADSAFKNCSDLKELDLSSNKLTIIPEAILQLPFLKSLD
LGENLLTDISNNSFQNLSQLTGLRLIDNQIGNLSAGMFWGLPSLQVLNLAKNKIQAIETE
TFQKNVQLEAVRLDGNFITDINGVFVSLTKLLWLNLSENQLVWFDYAFIPASLKWLDIHA
NFIEVLANYYKIQSNLRVKTLDASHNHIVSLSSISIPNSVELLFINNNLISSIETDTFLE
KSNLTRVDMYANEIESLGMDSLRISKVDGRPLPELYISGNPFRCDCTMKWLLLINSVSTR
EYPRVMDLENVICKESFVRGVKFLPVVSLNTKDFLCKYESYCVEDCHCCDFSFCNCKTVC
PDECSCYHDSTKATNVVDCSVKQLYLVPRDFPMGATHIYLDGNYYNELNETVFYSMRKAM
VLYLNSTGITSIQNETFRGLGDLRILHLDDNKIKRLQGLEFSKLNNLKELYLQNNGIEYI
SNVSFSFLSSLEVLRLDGNRLLNYGLWHLDNNKKLQSLFIGNNYWSCNCKYLQGFLLYIS
QNVEKVIDMHNLWCFNDDENRTRKQLNLNVTICSEISDTSVISAFFVSHNIPLLASALTG
FMLILLILALVFTFRYACRMWLYSNCGIKLSPLAGAFNDADKLYDAYICYSPKDEEFVIE
SLARELENGYPSYHLCLHYRDVPQFEATYAQFPDLVVEATEASRRIIVVLSKNFISTEWS
QIEFRQALQRALHKNPHKLILVAVGQVARDPDLKSYFKTGLEITWKEKRFWERLRYAMPS
SKRHGHKLKRLNYGRNSNTYTMDASVLNSTCQTLCGKSANSAERSPCDRPMSEHIYSTID
SDYSSNDFQGRHHQPQSVVLQHTVQTYLV
Download sequence
Identical sequences HMEL017479-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]