SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for IC33419AbApep2349 from Heliconius numata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IC33419AbApep2349
Domain Number 1 Region: 98-192
Classification Level Classification E-value
Superfamily SH2 domain 2.1e-19
Family SH2 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 228-259
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000222
Family SOCS box-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) IC33419AbApep2349
Sequence length 266
Sequence
DTKRDFSNTNLANSAILPERKSPVNTNKFVKFWKNKLLITGSVRSLQRYFGNKNTSDEYL
CNYSKRTDXXXSSEKQIIHLKSETKKDIDLENMHMKCQHSEGHSVLRGHHQHASVESCAI
YCQLSKHGWYWGGITSSEAEELLAGQHDNVFLVRDSYDSRHILCVSFRCVGRTLHARLRH
ANGLFSLNNETFVPANRISEHCATVDVKSKLFEMPVKLARPLNKICKELRIHCKFVIRQT
VSEDLWSKLPLPPNLIAYVSLGSDYI
Download sequence
Identical sequences IC33419AbApep2349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]