SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|10092619|ref|NP_065390.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10092619|ref|NP_065390.1|
Domain Number 1 Region: 73-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.19e-78
Family Ankyrin repeat 0.000000000863
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|10092619|ref|NP_065390.1|
Sequence length 317
Comment NF-kappa-B inhibitor alpha [Homo sapiens]
Sequence
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL
Download sequence
Identical sequences P25963
NP_065390.1.87134 NP_065390.1.92137 ENSP00000216797 ENSP00000216797 gi|10092619|ref|NP_065390.1| ENSP00000216797 9606.ENSP00000216797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]