SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|10140845|ref|NP_065387.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10140845|ref|NP_065387.1|
Domain Number 1 Region: 628-914
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.6e-82
Family Protein kinases, catalytic subunit 0.00000000319
Further Details:      
 
Domain Number 2 Region: 31-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.95e-70
Family Ephrin receptor ligand binding domain 0.0000017
Further Details:      
 
Domain Number 3 Region: 328-535
Classification Level Classification E-value
Superfamily Fibronectin type III 1.38e-40
Family Fibronectin type III 0.00000376
Further Details:      
 
Domain Number 4 Region: 934-1001
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.3e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Weak hits

Sequence:  gi|10140845|ref|NP_065387.1|
Domain Number - Region: 259-325,360-385
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000154
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|10140845|ref|NP_065387.1|
Sequence length 1005
Comment ephrin type-A receptor 8 isoform 1 precursor [Homo sapiens]
Sequence
MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEK
DKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDT
RTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHP
PGKLPEPQFYAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQR
DVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGS
LDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFG
LSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW
NMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE
SLRATATVSRCPPPAFVRSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLG
MVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL
Download sequence
Identical sequences P29322
9606.ENSP00000166244 NP_065387.1.87134 NP_065387.1.92137 gi|10140845|ref|NP_065387.1| ENSP00000166244 ENSP00000166244 ENSP00000166244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]