SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|103471993|ref|NP_056151.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|103471993|ref|NP_056151.2|
Domain Number 1 Region: 54-279
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.14e-59
Family Ankyrin repeat 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|103471993|ref|NP_056151.2|
Sequence length 632
Comment palmitoyltransferase ZDHHC17 [Homo sapiens]
Sequence
MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWD
IVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLG
GDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKG
QDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTV
ISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKE
FRQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
GIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQK
KKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHR
YFMGYLFFLLFMICWMIYGCISYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVF
HFMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEF
RCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV
Download sequence
Identical sequences A0A0D9QVI5 A0A2K5DY62 A0A2K5JN83 A0A2K5NCL4 A0A2K5QDI3 A0A2K5VZT6 A0A2K5XG33 A0A2K6FH74 A0A2K6V8A8 G1QY94 H2NI45 H2Q6I7 H9EPX7 I3MG95 Q8IUH5 U3DD78
ENSSTOP00000009752 ENSP00000403397 ENSP00000334868 ENSPTRP00000008906 ENSNLEP00000005915 NP_001247821.1.72884 NP_056151.2.87134 NP_056151.2.92137 XP_002823585.3.23681 XP_002920689.1.58354 XP_003259622.1.23891 XP_003832928.1.60992 XP_005330495.1.77405 XP_005571659.1.63531 XP_006737825.1.47382 XP_008002278.1.81039 XP_011819144.1.43180 XP_011836776.1.47321 XP_011905186.1.92194 XP_012503822.1.63892 XP_012605802.1.48125 XP_015338457.1.40921 XP_016054895.1.3490 XP_017386110.1.71028 XP_021534232.1.83697 XP_509231.3.37143 ENSPPYP00000005459 ENSP00000334868 ENSP00000403397 ENSNLEP00000005915 gi|103471993|ref|NP_056151.2| 9598.ENSPTRP00000008906 9600.ENSPPYP00000005459 9606.ENSP00000403397 ENSPPYP00000005459 ENSPTRP00000008906 ENSSTOP00000009752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]