SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|10518506|ref|NP_063916.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10518506|ref|NP_063916.1|
Domain Number 1 Region: 56-211
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.76e-59
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000451
Further Details:      
 
Domain Number 2 Region: 7-56
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000362
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|10518506|ref|NP_063916.1|
Sequence length 216
Comment coagulation factor VIII isoform b precursor [Homo sapiens]
Sequence
MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSM
PLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQK
TMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNS
LDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Download sequence
Identical sequences gi|10518506|ref|NP_063916.1| ENSP00000327895 ENSP00000470213 ENSP00000327895 NP_063916.1.87134 NP_063916.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]