SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|10835083|ref|NP_000321.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10835083|ref|NP_000321.1|
Domain Number 1 Region: 62-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.17e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|10835083|ref|NP_000321.1|
Sequence length 224
Comment retinoschisin precursor [Homo sapiens]
Sequence
MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCI
PECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSS
QWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNS
DRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
Download sequence
Identical sequences A0A0D9RQE1 A0A2K5IQ40 A0A2K5WBB2 A0A2K6DXK6 G1REZ1 H2QYD2 O15537
ENSNLEP00000011791 ENSNLEP00000011791 ENSMMUP00000006710 ENSP00000369320 ENSP00000369320 9544.ENSMMUP00000006710 9606.ENSP00000369320 ENSP00000369320 ENSMMUP00000006710 NP_000321.1.87134 NP_000321.1.92137 NP_001181840.1.72884 XP_003261161.1.23891 XP_003819588.1.60992 XP_011733561.1.29376 XP_011795608.1.43180 XP_015298942.1.63531 gi|10835083|ref|NP_000321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]