SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|109150435|ref|NP_001035869.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109150435|ref|NP_001035869.1|
Domain Number 1 Region: 493-592
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000023
Family Ankyrin repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|109150435|ref|NP_001035869.1|
Domain Number - Region: 70-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00646
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|109150435|ref|NP_001035869.1|
Sequence length 726
Comment ankyrin repeat and zinc finger domain-containing protein 1 [Homo sapiens]
Sequence
MSPAPDAAPAPASISLFDLSADAPVFQGLSLVSHAPGEALARAPRTSCSGSGERESPERK
LLQGPMDISEKLFCSTCDQTFQNHQEQREHYKLDWHRFNLKQRLKDKPLLSALDFEKQSS
TGDLSSISGSEDSDSASEEDLQTLDRERATFEKLSRPPGFYPHRVLFQNAQGQFLYAYRC
VLGPHQDPPEEAELLLQNLQSRGPRDCVVLMAAAGHFAGAIFQGREVVTHKTFHRYTVRA
KRGTAQGLRDARGGPSHSAGANLRRYNEATLYKDVRDLLAGPSWAKALEEAGTILLRAPR
SGRSLFFGGKGAPLQRGDPRLWDIPLATRRPTFQELQRVLHKLTTLHVYEEDPREAVRLH
SPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVEL
TVGTLDLCESEVLPKRRRRKRNKKEKSRDQEAGAHRTLLQQTQEEEPSTQSSQAVAAPLG
PLLDEAKAPGQPELWNALLAACRAGDVGVLKLQLAPSPADPRVLSLLSAPLGSGGFTLLH
AAAAAGRGSVVRLLLEAGADPTVQDSRARPPYTVAADKSTRNEFRRFMEKNPDAYDYNKA
QVPGPLTPEMEARQATRKREQKAARRQREEQQQRQQEQEEREREEQRRFAALSDREKRAL
AAERRLAAQLGAPTSPIPDSAIVNTRRCWSCGASLQGLTPFHYLDFSFCSTRCLQDHRRQ
AGRPSS
Download sequence
Identical sequences A0A024R464 Q9H8Y5
ENSP00000321617 ENSP00000386337 ENSP00000321617 ENSP00000386337 ENSP00000321617 NP_001035869.1.87134 NP_001035869.1.92137 NP_060559.2.87134 NP_060559.2.92137 9606.ENSP00000321617 gi|109150425|ref|NP_060559.2| gi|109150435|ref|NP_001035869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]