SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|109637795|ref|NP_937987.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109637795|ref|NP_937987.2|
Domain Number 1 Region: 139-237
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 6.8e-36
Family E2F dimerization segment 0.00026
Further Details:      
 
Domain Number 2 Region: 63-127
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-16
Family Cell cycle transcription factor e2f-dp 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|109637795|ref|NP_937987.2|
Sequence length 281
Comment transcription factor E2F6 [Homo sapiens]
Sequence
MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQYVSMRKALKVK
RPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS
KNHIRWIGSDLSNFGAVPQQKKLQEELSDLSAMEDALDELIKDCAQQLFELTDDKENERL
AYVTYQDIHSIQAFHEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQ
GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN
Download sequence
Identical sequences A0A0S2Z3K8 A0A2J8V434 H2QHG0 O75461
ENSP00000370936 ENSP00000370936 9598.ENSPTRP00000020042 9606.ENSP00000370936 gi|109637795|ref|NP_937987.2| GO.39667 HR4622 ENSPTRP00000020042 NP_001229273.1.37143 NP_937987.2.87134 NP_937987.2.92137 XP_003827023.1.60992 ENSPTRP00000020042 ENSP00000302159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]