SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|109637798|ref|NP_602296.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109637798|ref|NP_602296.2|
Domain Number 1 Region: 26-206
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.57e-65
Family The homologous-pairing domain of Rad52 recombinase 0.0000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|109637798|ref|NP_602296.2|
Sequence length 418
Comment DNA repair protein RAD52 homolog [Homo sapiens]
Sequence
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGG
QKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSY
HEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPR
QLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCS
SRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST
PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL
NNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
Download sequence
Identical sequences P43351 Q5DR82
ENSP00000351284 ENSP00000351284 ENSP00000387901 NP_001284348.1.87134 NP_001284348.1.92137 NP_602296.2.87134 NP_602296.2.92137 XP_005253777.1.92137 XP_005253778.1.92137 XP_011519292.1.92137 XP_011519293.1.92137 XP_016875258.1.92137 9606.ENSP00000351284 trt001000152.1 gi|109637798|ref|NP_602296.2| ENSP00000351284 ENSP00000387901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]