SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110815813|ref|NP_057460.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110815813|ref|NP_057460.3|
Domain Number 1 Region: 728-1080
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.25e-54
Family Ankyrin repeat 0.0000491
Further Details:      
 
Domain Number 2 Region: 221-409,474-516,615-681
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.66e-48
Family Ankyrin repeat 0.00064
Further Details:      
 
Domain Number 3 Region: 48-157
Classification Level Classification E-value
Superfamily POZ domain 8.37e-22
Family BTB/POZ domain 0.0066
Further Details:      
 
Domain Number 4 Region: 1105-1164
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.8e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00055
Further Details:      
 
Domain Number 5 Region: 426-569
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000104
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110815813|ref|NP_057460.3|
Sequence length 1170
Comment ankyrin repeat and FYVE domain-containing protein 1 isoform 1 [Homo sapiens]
Sequence
MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVAD
LYEQEQYSDLKIKVGDRHISAHKFVLAARSDSWSLANLSSTKELDLSDANPEVTMTMLRW
IYTDELEFREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNAS
TLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIE
MDSQLPGKLNEADHNGDLALDLALSRRLESIATTLVSHKADVDMVDKSGWSLLHKGIQRG
DLFAATFLIKNGAFVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANP
NMQDSKGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSV
NPFEDVPVVNGTSFDENSFAARLIQRGSHTDAPDTATGNCLLQRAAGAGNEAAALFLATN
GAHVNHRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLADS
VHLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTG
MHTIAAQLLGSGAAINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVSRTQDGETAL
QLAIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGP
GPGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAAS
WGLEETVQCLLEFGANVNAQDAEGRTPIHVAISSQHGVIIQLLVSHPDIHLNVRDRQGLT
PFACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNS
RVQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLL
ENGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKE
NAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVN
IFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTARFGVTTRKHHCRHCGRLLCHKCST
KEIPIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences NP_057460.3.87134 NP_057460.3.92137 9606.ENSP00000343362 NYSGRC-110815813 gi|110815813|ref|NP_057460.3| ENSP00000459775 ENSP00000459775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]