SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111118978|ref|NP_059145.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111118978|ref|NP_059145.2|
Domain Number 1 Region: 613-914
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-83
Family Protein kinases, catalytic subunit 0.0000000000861
Further Details:      
 
Domain Number 2 Region: 20-195
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.12e-77
Family Ephrin receptor ligand binding domain 0.0000000111
Further Details:      
 
Domain Number 3 Region: 324-529
Classification Level Classification E-value
Superfamily Fibronectin type III 5.22e-41
Family Fibronectin type III 0.0000216
Further Details:      
 
Domain Number 4 Region: 910-984
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.52e-21
Family SAM (sterile alpha motif) domain 0.0000281
Further Details:      
 
Domain Number 5 Region: 253-324,362-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000227
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111118978|ref|NP_059145.2|
Sequence length 986
Comment ephrin type-B receptor 2 isoform 1 precursor [Homo sapiens]
Sequence
MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQ
VCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADF
DSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQD
YGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLY
CNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGA
TNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNI
ICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPF
SPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSE
YNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEK
LPLIIGSSAAGLVFLIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPF
TYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYT
EKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTV
IQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTY
TSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIE
QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI
NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTL
AGHQKKILNSIQVMRAQMNQIQSVEV
Download sequence
Identical sequences gi|111118978|ref|NP_059145.2| NP_059145.2.87134 NP_059145.2.92137 ENSP00000363761 ENSP00000363761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]