SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11225607|ref|NP_059112.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11225607|ref|NP_059112.1|
Domain Number 1 Region: 392-560
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.22e-27
Family Toll/Interleukin receptor TIR domain 0.00084
Further Details:      
 
Domain Number 2 Region: 37-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000141
Family I set domains 0.0098
Further Details:      
 
Domain Number 3 Region: 248-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000341
Family I set domains 0.023
Further Details:      
 
Domain Number 4 Region: 160-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000502
Family I set domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|11225607|ref|NP_059112.1|
Sequence length 686
Comment X-linked interleukin-1 receptor accessory protein-like 2 [Homo sapiens]
Sequence
MKPPFLLALVVCSVVSTNLKMVSKRNSVDGCIDWSVDLKTYMALAGEPVRVKCALFYSYI
RTNYSTAQSTGLRLMWYKNKGDLEEPIIFSEVRMSKEEDSIWFHSAEAQDSGFYTCVLRN
STYCMKVSMSLTVAENESGLCYNSRIRYLEKSEVTKRKEISCPDMDDFKKSDQEPDVVWY
KECKPKMWRSIIIQKGNALLIQEVQEEDGGNYTCELKYEGKLVRRTTELKVTALLTDKPP
KPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEI
RLLKEHLGEKEVELALIFDSVVEADLANYTCHVENRNGRKHASVLLRKKDLIYKIELAGG
LGAIFLLLVLLVVIYKCYNIELMLFYRQHFGADETNDDNKEYDAYLSYTKVDQDTLDCDN
PEEEQFALEVLPDVLEKHYGYKLFIPERDLIPSGTYMEDLTRYVEQSRRLIIVLTPDYIL
RRGWSIFELESRLHNMLVSGEIKVILIECTELKGKVNCQEVESLKRSIKLLSLIKWKGSK
SSKLNSKFWKHLVYEMPIKKKEMLPRCHVLDSAEQGLFGELQPIPSIAMTSTSATLVSSQ
ADLPEFHPSDSMQIRHCCRGYKHEIPATTLPVPSLGNHHTYCNLPLTLLNGQLPLNNTLK
DTQEFHRNSSLLPLSSKELSFTSDIW
Download sequence
Identical sequences Q9NP60
9606.ENSP00000344976 ENSP00000361663 NP_059112.1.87134 NP_059112.1.92137 XP_016884892.1.92137 ENSP00000344976 NYSGRC-IgSF-IRPL2_HUMAN gi|11225607|ref|NP_059112.1| ENSP00000344976 ENSP00000361663 ENSP00000469497 ENSP00000472540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]