SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114842396|ref|NP_694960.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114842396|ref|NP_694960.2|
Domain Number 1 Region: 268-358
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-17
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 2 Region: 137-198
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000127
Family Ankyrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|114842396|ref|NP_694960.2|
Sequence length 763
Comment ankyrin repeat and fibronectin type-III domain-containing protein 1 [Homo sapiens]
Sequence
MEASLTRRLLFKDRHFTCSKIIGRRFACFAQRLSHRRKQSQCDLLNESTGQLPTTCSSAA
SNSINWNCRVKMTQQMQNLHLCQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFR
TRTDRLSLRKTSVNFQGNEAMFEAVEQQDMDAVQILLYQYTPEELDLNTPNSEGLTPLDI
AIMTNNVPIARILLRTGARESPHFVSLESRAMHLNTLVQEAQERVSELSAQVENEGFTLD
NTEKEKQLKAWEWRYRLYRRMKTGFEHARAPEMPTNVCLMVTSSTSLTVSFQEPLSVNAA
VVTRYKVEWSMSEDFSPLAGEIIMDNLQTLRCTITGLTMGQQYFVQVSAYNMKGWGPAQT
TTPACASPSNWKDYDDREPRHKGQSEVLEGLLQQVRALHQHYSCRESTKLQTTGRKQSVS
RSLKHLFHSSNKFVKTLKRGLYIAVIFYYKDNILVTNEDQVPIVEIDDSHTSSITQDFLW
FTKLSCMWEDIRWLRQSIPISSSSSTVLQTRQKMLAATAQLQNLLGTHNLGRVYYEPIKD
RHGNILIVTIREVEMLYSFFNGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYH
KRSHQRLFPGLYLGYLKLCSSVDQIKVLVTQKLPNILCHVKIRENNNISREEWEWIQKLS
GSESMESVDHTSDCPMQLFFYELQMAVKALLQQINIPLHQARNFRLYTQEVLEMGHNVSF
LLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT
Download sequence
Identical sequences Q8N957
9606.ENSP00000321627 NP_694960.2.87134 NP_694960.2.92137 ENSP00000321627 gi|114842396|ref|NP_694960.2| ENSP00000321627 NYSGRC-114842396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]