SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|115298672|ref|NP_000256.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115298672|ref|NP_000256.3|
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily PX domain 9.68e-44
Family PX domain 0.0000000787
Further Details:      
 
Domain Number 2 Region: 217-331
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-26
Family SH3-domain 0.000000425
Further Details:      
 
Domain Number 3 Region: 149-216
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-19
Family SH3-domain 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|115298672|ref|NP_000256.3|
Sequence length 390
Comment neutrophil cytosol factor 1 [Homo sapiens]
Sequence
MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPI
EAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCGTLMSLPTKISRCPHLLDFFKV
RPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTG
DVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAV
EGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPP
RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSK
PQPAVPPRPSADLILNRCSESTKRKLASAV
Download sequence
Identical sequences P14598
ENSP00000289473 9606.ENSP00000289473 ENSP00000289473 gi|115298672|ref|NP_000256.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]