SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116325987|ref|NP_872409.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116325987|ref|NP_872409.2|
Domain Number 1 Region: 49-329
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.75e-51
Family Ankyrin repeat 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116325987|ref|NP_872409.2|
Sequence length 389
Comment ankyrin repeat domain-containing protein 42 [Homo sapiens]
Sequence
MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHWLLWHGADITH
VTTRGWTASHIAAIRGQDACVQALIMNGANLTAQDDRGCTPLHLAATHGHSFTLQIMLRS
GVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCF
KFLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPG
HVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITN
KAGERPSDVAKRFAHLAAVKLLEELQKYDIDDENEIDENDVKYFIRHGVEGSTDAKDDLC
LSDLDKTDARRPSKNCRASWSMNDYVEKN
Download sequence
Identical sequences K7AGK6 Q8N9B4
gi|116325987|ref|NP_872409.2| ENSP00000377051 9598.ENSPTRP00000007098 9606.ENSP00000345328 ENSP00000377051 NP_872409.2.87134 NP_872409.2.92137 XP_003822041.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]