SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116642871|ref|NP_067092.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116642871|ref|NP_067092.2|
Domain Number 1 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.23e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 8 Region: 512-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000045
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116642871|ref|NP_067092.2|
Sequence length 563
Comment zinc finger protein 708 [Homo sapiens]
Sequence
MGPLTFMDVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAVSNLDLITCLEQGK
EPWNMKRHEMAAKPPAMCSHFAKDLRPEQYIKNSFQQVILRRYGKCGYQKGCKSVDEHKL
HKGGHKGLNRCVTTTQSKIVQCDKYVKVFHKYSNAKRHKIRHTGKNPFKCKECGKSFCML
SQLTQHEIIHTGEKPYKCEECGKAFKKSSNLTNHKIIHTGEKPYKCEECGKAFNQSSTLT
RHKIIHTGEKLYKCEECGKAFNRSSNLTKHKIVHTGEKPYKCEECGKAFKQSSNLTNHKK
IHTGEKPYKCGECGKAFTLSSHLTTHKRIHTGEKPYKCEECGKAFSVFSTLTKHKIIHTE
EKPYKCEECGKAFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKSSTLTYHKVIHTGKKPY
KCEECGKAFSIFSILTKHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEE
CGKSFILSSHLTTHKIIHTGEKPYKCKECGKAFNQSSTLMKHKIIHTGEKPYKCEECGKA
FNQSPNLTKHKRIHTKEKPYKCK
Download sequence
Identical sequences NP_067092.2.87134 NP_067092.2.92137 ENSP00000349401 ENSP00000349401 gi|116642871|ref|NP_067092.2| ENSP00000349401 9606.ENSP00000349401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]