SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116812636|ref|NP_071748.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116812636|ref|NP_071748.2|
Domain Number 1 Region: 38-365
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.77e-33
Family YeaZ-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116812636|ref|NP_071748.2|
Sequence length 414
Comment probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1 [Homo sapiens]
Sequence
MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNV
LGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGL
ALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALV
QGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIK
PPLHHAKNCDFSFTGLQHVTDKIIMKKEKEEGIEKGQILSSAADIAATVQHTMACHLVKR
THRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLCPPPRLCTDNG
IMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQLKMEI
Download sequence
Identical sequences Q9H4B0
ENSP00000264151 gi|116812636|ref|NP_071748.2| NP_071748.2.87134 NP_071748.2.92137 XP_005246823.1.92137 XP_006712748.1.92137 XP_011509933.1.92137 XP_016860165.1.92137 XP_016860166.1.92137 XP_016860167.1.92137 XP_016860168.1.92137 XP_016860169.1.92137 9606.ENSP00000264151 HR6633 NYSGRC-116812636 ENSP00000264151 ENSP00000429697 ENSP00000264151 ENSP00000429697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]