SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116875852|ref|NP_065822.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116875852|ref|NP_065822.2|
Domain Number 1 Region: 547-902
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.67e-119
Family Hect, E3 ligase catalytic domain 0.0000000743
Further Details:      
 
Domain Number 2 Region: 33-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.03e-57
Family Ankyrin repeat 0.0001
Further Details:      
 
Weak hits

Sequence:  gi|116875852|ref|NP_065822.2|
Domain Number - Region: 248-329,485-518
Classification Level Classification E-value
Superfamily ARM repeat 0.0959
Family Clathrin adaptor core protein 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116875852|ref|NP_065822.2|
Sequence length 909
Comment E3 ubiquitin-protein ligase HACE1 [Homo sapiens]
Sequence
MERAMEQLNRLTRSLRRARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYA
FGRVKRSLLHIAANCGSVECLVLLLKKGANPNYQDISGCTPLHLAARNGQKKCMSKLLEY
SADVNICNNEGLTAIHWLAVNGRTELLHDLVQHVSDVDVEDAMGQTALHVACQNGHKTTV
QCLLDSGADINRPNVSGATPLYFACSHGQRDTAQILLLRGAKYLPDKNGVTPLDLCVQGG
YGETCEVLIQYHPRLFQTIIQMTQNEDLRENMLRQVLEHLSQQSESQYLKILTSLAEVAT
TNGHKLLSLSSNYDAQMKSLLRIVRMFCHVFRIGPSSPSNGIDMGYNGNKTPRSQVFKPL
ELLWHSLDEWLVLIATELMKNKRDSTEITSILLKQKGQDQDAASIPPFEPPGPGSYENLS
TGTRESKPDALAGRQEASADCQDVISMTANRLSAVIQAFYMCCSCQMPPGMTSPRFIEFV
CKHDEVLKCFVNRNPKIIFDHFHFLLECPELMSRFMHIIKAQPFKDRCEWFYEHLHSGQP
DSDMVHRPVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREW
FDILSNEIVNPDYALFTQSADGTTFQPNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNI
YFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGAMEE
VPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQLFDEYE
LELLLSGMPEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSR
VPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALH
CGSYGYTMA
Download sequence
Identical sequences H2PJX3 Q8IYU2
ENSP00000262903 ENSPPYP00000018892 NP_065822.2.87134 NP_065822.2.92137 XP_002817239.1.23681 XP_003824397.1.60992 ENSP00000262903 ENSPPYP00000018892 gi|116875852|ref|NP_065822.2| ENSP00000262903 9600.ENSPPYP00000018892 9606.ENSP00000262903 HR6100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]