SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118150656|ref|NP_062618.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118150656|ref|NP_062618.2|
Domain Number 1 Region: 25-217
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-58
Family Ankyrin repeat 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118150656|ref|NP_062618.2|
Sequence length 254
Comment ankyrin repeat domain-containing protein 7 [Homo sapiens]
Sequence
MNKLFSFWKRKNETRSQGYNLREKDLKKLHRAASVGDLKKLKEYLQIKKYDVNMQDKKYR
TPLHLACANGHTDVVLFLIEQQCKINVRDSENKSPLIKAVQCQNEDCATILLNFGADPDL
RDIRYNTVLHYAVCGQSLSLVEKLLEYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEK
GADVNASDNYQRTALILAVSGEPPCLVKLLLQQGVELCYEGIVDSQLRNMFISMVLLHRY
PQFTASHGKKKHAK
Download sequence
Identical sequences A0A140VJE5 A0A2I3SVD9 Q92527
ENSP00000265224 ENSP00000349612 9606.ENSP00000265224 gi|118150656|ref|NP_062618.2| ENSP00000265224 NP_062618.2.87134 NP_062618.2.92137 XP_003808692.2.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]