SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118343647|ref|NP_057210.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118343647|ref|NP_057210.2|
Domain Number 1 Region: 5-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.31e-32
Family APC10-like 0.000000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118343647|ref|NP_057210.2|
Sequence length 144
Comment heat shock protein beta-11 [Homo sapiens]
Sequence
MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIE
RLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIV
SAFDHFASVHSVSAEGTVVSNLSS
Download sequence
Identical sequences G3R552 Q9Y547
ENSGGOP00000010420 gi|118343647|ref|NP_057210.2| 9606.ENSP00000194214 ENSP00000194214 ENSP00000194214 ENSGGOP00000010420 GO.35166 HR1958 NP_001303864.1.87134 NP_001303864.1.92137 NP_057210.2.87134 NP_057210.2.92137 XP_004025889.1.27298 XP_004025890.1.27298 XP_018874454.1.27298 XP_018874460.1.27298 XP_018874462.1.27298 ENSP00000194214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]