SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119220585|ref|NP_996803.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119220585|ref|NP_996803.2|
Domain Number 1 Region: 573-728
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-37
Family MAM domain 0.00089
Further Details:      
 
Domain Number 2 Region: 63-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-32
Family MAM domain 0.0058
Further Details:      
 
Domain Number 3 Region: 890-1054
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-31
Family MAM domain 0.0027
Further Details:      
 
Domain Number 4 Region: 731-888
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-26
Family MAM domain 0.001
Further Details:      
 
Domain Number 5 Region: 270-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-17
Family MAM domain 0.014
Further Details:      
 
Domain Number 6 Region: 225-264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 7 Region: 489-571
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000116
Family MAM domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|119220585|ref|NP_996803.2|
Domain Number - Region: 456-495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000327
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number - Region: 28-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0262
Family LDL receptor-like module 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119220585|ref|NP_996803.2|
Sequence length 1137
Comment apical endosomal glycoprotein precursor [Homo sapiens]
Sequence
MPLSSHLLPALVLFLAGSSGWAWVPNHCRSPGQAVCNFVCDCRDCSDEAQCGYHGASPTL
GAPFACDFEQDPCGWRDISTSGYSWLRDRAGAALEGPGPHSDHTLGTDLGWYMAVGTHRG
KEASTAALRSPTLREAASSCKLRLWYHAASGDVAELRVELTHGAETLTLWQSTGPWGPGW
QELAVTTGRIRGDFRVTFSATRNATHRGAVALDDLEFWDCGLPTPQANCPPGHHHCQNKV
CVEPQQLCDGEDNCGDLSDENPLTCGRHIATDFETGLGPWNRSEGWSRNHRAGGPERPSW
PRRDHSRNSAQGSFLVSVAEPGTPAILSSPEFQASGTSNCSLVFYQYLSGSEAGCLQLFL
QTLGPGAPRAPVLLRRRRGELGTAWVRDRVDIQSAYPFQILLAGQTGPGGVVGLDDLILS
DHCRPVSEVSTLQPLPPGPRAPAPQPLPPSSRLQDSCKQGHLACGDLCVPPEQLCDFEEQ
CAGGEDEQACGTTDFESPEAGGWEDASVGRLQWRRVSAQESQGSSAAAAGHFLSLQRAWG
QLGAEARVLTPLLGPSGPSCELHLAYYLQSQPREVSCNFERDTCSWYPGHLSDTHWRWVE
SRGPDHDHTTGQGHFVLLDPTDPLAWGHSAHLLSRPQVPAAPTECLSFWYHLHGPQIGTL
RLAMRREGEETHLWSRSGTQGNRWHEAWATLSHQPGSHAQYQLLFEGLRDGYHGTMALDD
VAVRPGPCWAPNYCSFEDSDCGFSPGGQGLWRRQANASGHAAWGPPTDHTTETAQGHYMV
VDTSPDALPRGQTASLTSKEHRPLAQPACLTFWYHGSLRSPGTLRVYLEERGRHQVLSLS
AHGGLAWRLGSMDVQAERAWRVVFEAVAAGVAHSYVALDDLLLQDGPCPQPGSCDFESGL
CGWSHLAWPGLGGYSWDWGGGATPSRYPQPPVDHTLGTEAGHFAFFETGVLGPGGRAAWL
RSEPLPATPASCLRFWYHMGFPEHFYKGELKVLLHSAQGQLAVWGAGGHRRHQWLEAQVE
VASAKEFQIVFEATLGGQPALGPIALDDVEYLAGQHCQQPAPSPGNTAAPGSVPAVVGSA
LLLLMLLVLLGLGGRRWLQKKGSCPFQSNTEATAPGFDNILFNADGVTLPASVTSDP
Download sequence
Identical sequences ENSP00000319388 9606.ENSP00000319388 gi|119220585|ref|NP_996803.2| ENSP00000319388 NP_996803.2.87134 NP_996803.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]