SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119466532|ref|NP_001073291.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119466532|ref|NP_001073291.1|
Domain Number 1 Region: 2765-2929
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.08e-36
Family Laminin G-like module 0.0000000639
Further Details:      
 
Domain Number 2 Region: 2934-3115
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.9e-35
Family Laminin G-like module 0.0000000325
Further Details:      
 
Domain Number 3 Region: 2336-2520
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-31
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 2516-2708
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.26e-27
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 5 Region: 2152-2328
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-24
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 815-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 865-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 8 Region: 1420-1471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 757-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 10 Region: 1477-1529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000402
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 11 Region: 287-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 12 Region: 918-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000195
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 13 Region: 410-538,723-741
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000455
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 14 Region: 1060-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 15 Region: 967-1016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000187
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 16 Region: 1887-2070
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000131
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.011
Further Details:      
 
Domain Number 17 Region: 344-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 18 Region: 1527-1567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 19 Region: 1014-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 20 Region: 89-168
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000992
Family APC10-like 0.038
Further Details:      
 
Weak hits

Sequence:  gi|119466532|ref|NP_001073291.1|
Domain Number - Region: 1833-1938
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.000104
Family ADP-ribosylating toxins 0.026
Further Details:      
 
Domain Number - Region: 1119-1163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000229
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 1377-1406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family Laminin-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119466532|ref|NP_001073291.1|
Sequence length 3118
Comment laminin subunit alpha-2 isoform b precursor [Homo sapiens]
Sequence
MPGAAGVLLLLLLSGGLGGVQAQRPQQQRQSQAHQQRGLFPAVLNLASNALITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP
ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIG
SLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED
PCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM
SGWYLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGG
QLTFTISYDLEEEEEDTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESF
TIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAA
VEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHT
GGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYT
GPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCEL
CADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQS
ARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLG
NNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCN
CHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNV
EGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDE
ALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFE
AREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRV
HRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKC
DCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQ
HHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRG
YEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC
KHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMTQELK
HLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGE
FIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIA
EDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDDAWDLLREATDKIREA
NRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQ
TKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFN
ATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGCLQKSFRILNE
AKKLANDVKENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDK
ARQANDTAKDVLAQITELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVK
NLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKP
EIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYP
DLTIDDSYWYRIVASRTGRNGTISVRALDGPKASIVPSTHHSTSPPGYTILDVDANAMLF
VGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGT
IQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKV
SYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGL
DLKADDKIYFGGLPTLRNLRPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLE
NVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQTGQA
YYVILLNRGRLEVHLSTGARTMRKIVIRPEPNLFHDGREHSVHVERTRGIFTVQVDENRR
YMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIWNLVINSVPMDFARPVSFKN
ADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALLIGSK
QFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGLPY
FSYDLGSGDTHTMIPTKINDGQWHKIKIMRSKQEGILYVDGASNRTISPKKADILDVVGM
LYVGGLPINYTTRRIGPVTYSIDGCVRNLHMAEAPADLEQPTSSFHVGTCFANAQRGTYF
DGTGFAKAVGGFKVGLDLLVEFEFRTTTTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNG
AGRFTAVYDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPV
FVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
Download sequence
Identical sequences NP_001073291.1.87134 NP_001073291.1.92137 gi|119466532|ref|NP_001073291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]