SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11968057|ref|NP_071941.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11968057|ref|NP_071941.1|
Domain Number 1 Region: 143-394
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.5e-66
Family Actin/HSP70 0.0000243
Further Details:      
 
Domain Number 2 Region: 2-135
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.42e-31
Family Actin/HSP70 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|11968057|ref|NP_071941.1|
Sequence length 396
Comment actin-related protein 6 [Homo sapiens]
Sequence
MTTLVLDNGAYNAKIGYSHENVSVIPNCQFRSKTARLKTFTANQIDEIKDPSGLFYILPF
QKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEILFEEYQFQ
AVLRVNAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLL
TNHLKEIISYRQLHVMDETHVINQVKEDVCYVSQDFYRDMDIAKLKGEENTVMIDYVLPD
FSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEMGIPEAIVY
SIQNLPEEMQPHFFKNIVLTGGNSLFPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAW
EGGKLISENDDFEDMVVTREDYEENGHSVCEEKFDI
Download sequence
Identical sequences A0A2I3HU17 A0A2K5J350 A0A2K6AJW1 A0A2K6RAV6 G2HGM5 G7PJA1 H2NID3 H9FYG9 I3M525 M3XEH0 Q9GZN1
ENSP00000188312 ENSP00000188312 ENSSTOP00000004390 ENSP00000188312 gi|11968057|ref|NP_071941.1| ENSNLEP00000007474 ENSPPYP00000005551 ENSNLEP00000007474 ENSPPYP00000005551 NP_001267062.1.37143 NP_071941.1.87134 NP_071941.1.92137 XP_003832652.1.60992 XP_003989206.1.62641 XP_004403919.1.74151 XP_005322436.1.77405 XP_006730221.1.47382 XP_007085717.1.5354 XP_009246419.1.23681 XP_012355623.1.23891 XP_012906963.1.14098 XP_014926340.1.86478 XP_019302095.1.44245 XP_019587761.1.88060 XP_021543222.1.83697 9600.ENSPPYP00000005551 9606.ENSP00000188312 ENSSTOP00000004390 NYSGRC-11968057 ENSFCAP00000025028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]