SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119943098|ref|NP_000101.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119943098|ref|NP_000101.2|
Domain Number 1 Region: 534-839
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.07e-76
Family FMN-linked oxidoreductases 0.0000000000287
Further Details:      
 
Domain Number 2 Region: 9-198
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.1e-38
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.0000000551
Further Details:      
 
Domain Number 3 Region: 188-439
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 6.28e-35
Family N-terminal domain of adrenodoxin reductase-like 0.000000568
Further Details:      
 
Domain Number 4 Region: 853-1012
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.48e-30
Family Ferredoxin domains from multidomain proteins 0.000000168
Further Details:      
 
Domain Number 5 Region: 410-508
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000494
Family N-terminal domain of adrenodoxin reductase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119943098|ref|NP_000101.2|
Sequence length 1025
Comment dihydropyrimidine dehydrogenase [NADP+] isoform 1 [Homo sapiens]
Sequence
MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFD
DIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDN
PLGLTCGMVCPTSDLCVGGCNLYATEEGPINIGGLQQFATEVFKAMSIPQIRNPSLPPPE
KMSEAYSAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGLSTSEIPQFRLPYDV
VNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAFIGIGLPEPNKDAIFQGLTQD
QGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATSALRCGARRVF
IVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKGGRIVAMQFVRTEQDETGKWN
EDEDQMVHLKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPETMQTSEAWVFAGG
DVVGLANTTVESVNDGKQASWYIHKYVQSQYGASVSAKPELPLFYTPIDLVDISVEMAGL
KFINPFGLASATPATSTSMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMY
GPGQSSFLNIELISEKTAAYWCQSVTELKADFPDNIVIASIMCSYNKNDWTELAKKSEDS
GADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVQIPFFAKLTPNVTDIVSI
ARAAKEGGANGVTATNTVSGLMGLKSDGTPWPAVGIAKRTTYGGVSGTAIRPIALRAVTS
IARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYL
KSIEELQDWDGQSPATVSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQ
NVAFSPLKRNCFIPKRPIPTIKDVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCY
MTCNDSGYQAIQFDPETHLPTITDTCTGCTLCLSVCPIVDCIKMVSRTTPYEPKRGVPLS
VNPVC
Download sequence
Identical sequences Q12882
NP_000101.2.87134 NP_000101.2.92137 ENSP00000359211 gi|119943098|ref|NP_000101.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]