SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|12746412|ref|NP_075526.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|12746412|ref|NP_075526.1|
Domain Number 1 Region: 154-299
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.23e-36
Family Ankyrin repeat 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|12746412|ref|NP_075526.1|
Sequence length 313
Comment ankyrin repeat family A protein 2 [Homo sapiens]
Sequence
MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRF
DMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTT
KHFSPIKQSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDE
EGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVD
VNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVI
ESHLLKLLQNIKE
Download sequence
Identical sequences A0A024RAN7 Q9H9E1
NP_075526.1.87134 NP_075526.1.92137 ENSP00000296785 gi|12746412|ref|NP_075526.1| ENSP00000296785 GO.40690 HR5999 9606.ENSP00000296785 ENSP00000296785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]