SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|128485756|ref|NP_001076044.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|128485756|ref|NP_001076044.1|
Domain Number 1 Region: 90-177
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.61e-26
Family Canonical RBD 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|128485756|ref|NP_001076044.1|
Sequence length 312
Comment RNA binding protein fox-1 homolog 3 [Homo sapiens]
Sequence
MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGS
EASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKRLHVSNIPFRFRDPDLRQMFG
QFGKILDVEIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTN
KKTGNPYTNGWKLNPVVGAVYGPEFYAVTGFPYPTTGTAVAYRGAHLRGRGRAVYNTFRA
APPPPPIPTYGAVVYQDGFYGAEIYGGYAAYRYAQPAAAAAAYSDSYGRVYAAADPYHHT
IGPAATYSIGTM
Download sequence
Identical sequences A0A2I2Y2Y5 A0A2J8Y239 A6NFN3 H2QE03
ENSP00000463653 gi|128485756|ref|NP_001076044.1| ENSP00000393262 ENSP00000408395 ENSP00000463653 ENSP00000466683 9606.ENSP00000408395 NP_001076044.1.87134 NP_001076044.1.92137 XP_016788545.1.37143 XP_016879699.1.92137 XP_018883475.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]