SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13027602|ref|NP_076424.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13027602|ref|NP_076424.1|
Domain Number 1 Region: 209-279
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-27
Family PCI domain (PINT motif) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13027602|ref|NP_076424.1|
Sequence length 314
Comment DDRGK domain-containing protein 1 precursor [Homo sapiens]
Sequence
MVAPVWYLVAAALLVGFILFLTRSRGRAASAGQEPLHNEELAGAGRVAQPGPLEPEEPRA
GGRPRRRRDLGSRLQAQRRAQRVAWAEADENEEEAVILAQEEEGVEKPAETHLSGKIGAK
KLRKLEEKQARKAQREAEEAEREERKRLESQREAEWKKEEERLRLEEEQKEEEERKAREE
QAQREHEEYLKLKEAFVVEEEGVGETMTEEQSQSFLTEFINYIKQSKVVLLEDLASQVGL
RTQDTINRIQDLLAEGTITGVIDDRGKFIYITPEELAAVANFIRQRGRVSIAELAQASNS
LIAWGRESPAQAPA
Download sequence
Identical sequences Q96HY6
NP_076424.1.87134 NP_076424.1.92137 ENSP00000346483 9606.ENSP00000346483 gi|13027602|ref|NP_076424.1| ENSP00000346483 ENSP00000346483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]