SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13129074|ref|NP_076986.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13129074|ref|NP_076986.1|
Domain Number 1 Region: 53-106
Classification Level Classification E-value
Superfamily GLA-domain 2.02e-19
Family GLA-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13129074|ref|NP_076986.1|
Sequence length 226
Comment transmembrane gamma-carboxyglutamic acid protein 4 precursor [Homo sapiens]
Sequence
MFTLLVLLSQLPTVTLGFPHCARGPKASKHAGEEVFTSKEEANFFIHRRLLYNRFDLELF
TPGNLERECNEELCNYEEAREIFVDEDKTIAFWQEYSAKGPTTKSDGNREKIDVMGLLTG
LIAAGVFLVIFGLLGYYLCITKCNRLQHPCSSAVYERGRHTPSIIFRRPEEAALSPLPPS
VEDAGLPSYEQAVALTRKHSVSPPPPYPGHTKGFRVFKKSMSLPSH
Download sequence
Identical sequences A0A0S2Z5N9 Q9BZD6
9606.ENSP00000257836 gi|13129074|ref|NP_076986.1| ENSP00000257836 NP_076986.1.87134 NP_076986.1.92137 XP_006718377.1.92137 ENSP00000257836 ENSP00000257836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]