SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13129098|ref|NP_077000.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13129098|ref|NP_077000.1|
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.15e-47
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 243-286
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000196
Family SOCS box-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13129098|ref|NP_077000.1|
Sequence length 288
Comment ankyrin repeat and SOCS box protein 8 [Homo sapiens]
Sequence
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCA
CMVSDADCVELLLEKGAEVNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDT
PLHWAAFKNNAECVRALLESGASVNALDYNNDTPLSWAAMKGNLESVSILLDYGAEVRVI
NLIGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGHFELRKNGTMPREVARDPQLCEKL
TVLCSAPGTLKTLARYAVRRSLGLQYLPDAVKGLPLPASLKEYLLLLE
Download sequence
Identical sequences A0A096MRB6 A0A0D9R1V8 A0A1D5QWM4 A0A2K5IY51 A0A2K5LL64 A0A2K5Z4S1 A0A2K6CQB6 G1S889 G3QUD1 G7PHQ2 Q9H765
ENSP00000320893 ENSP00000445622 NP_001248650.1.72884 NP_001306225.1.87134 NP_001306225.1.92137 NP_001306226.1.87134 NP_001306226.1.92137 NP_077000.1.87134 NP_077000.1.92137 XP_003252269.1.23891 XP_003252270.1.23891 XP_003252271.1.23891 XP_003825839.1.60992 XP_004053085.1.27298 XP_005570745.1.63531 XP_005570746.1.63531 XP_005570747.1.63531 XP_005570748.1.63531 XP_008001229.1.81039 XP_008001230.1.81039 XP_008001231.1.81039 XP_008001232.1.81039 XP_008001233.1.81039 XP_008001234.1.81039 XP_008001235.1.81039 XP_008001236.1.81039 XP_008001237.1.81039 XP_008949385.1.60992 XP_011758624.1.29376 XP_011758625.1.29376 XP_011758626.1.29376 XP_011758628.1.29376 XP_011758629.1.29376 XP_011791641.1.43180 XP_011791642.1.43180 XP_011791643.1.43180 XP_011791644.1.43180 XP_011843036.1.47321 XP_011843037.1.47321 XP_011843038.1.47321 XP_011843039.1.47321 XP_011903904.1.92194 XP_011903905.1.92194 XP_011903906.1.92194 XP_011903907.1.92194 XP_011903908.1.92194 XP_011903910.1.92194 XP_011903911.1.92194 XP_011903912.1.92194 XP_011903913.1.92194 XP_011903914.1.92194 XP_011903915.1.92194 XP_011903916.1.92194 XP_012363892.1.23891 XP_015006967.1.72884 XP_015006968.1.72884 XP_015006969.1.72884 XP_015286339.1.63531 XP_018894164.1.27298 ENSPANP00000002315 gi|13129098|ref|NP_077000.1| ENSNLEP00000021728 ENSNLEP00000021728 ENSP00000320893 ENSP00000445622 ENSGGOP00000006331 ENSGGOP00000006331 ENSP00000320893 9544.ENSMMUP00000002743 9606.ENSP00000320893 ENSMMUP00000002743 ENSMMUP00000002743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]