SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|131412225|ref|NP_705694.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|131412225|ref|NP_705694.2|
Domain Number 1 Region: 333-411
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-25
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 102-136
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000214
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|131412225|ref|NP_705694.2|
Domain Number - Region: 200-329
Classification Level Classification E-value
Superfamily Prefoldin 0.000288
Family Prefoldin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|131412225|ref|NP_705694.2|
Sequence length 458
Comment keratin, type I cytoskeletal 13 isoform a [Homo sapiens]
Sequence
MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSG
FGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGGLLTGNEKITMQNLNDRLASYLE
KVRALEEANADLEVKIRDWHLKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEI
DNARLAADDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMK
KNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKS
AELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQL
QQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFP
SSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Download sequence
Identical sequences H2QCZ4
gi|131412225|ref|NP_705694.2| ENSPTRP00000015614 9598.ENSPTRP00000015615 ENSPTRP00000015615 NP_705694.2.87134 NP_705694.2.92137 XP_003315487.1.37143 XP_003813892.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]