SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|131412228|ref|NP_002265.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|131412228|ref|NP_002265.2|
Domain Number 1 Region: 333-411
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.27e-25
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 102-136
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000188
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|131412228|ref|NP_002265.2|
Domain Number - Region: 199-329
Classification Level Classification E-value
Superfamily Prefoldin 0.000288
Family Prefoldin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|131412228|ref|NP_002265.2|
Sequence length 420
Comment keratin, type I cytoskeletal 13 isoform b [Homo sapiens]
Sequence
MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSG
FGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGGLLTGNEKITMQNLNDRLASYLE
KVRALEEANADLEVKIRDWHLKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEI
DNARLAADDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMK
KNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKS
AELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQL
QQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP
Download sequence
Identical sequences A0A2J8KGB2
NP_002265.2.87134 NP_002265.2.92137 XP_003813893.1.60992 gi|131412228|ref|NP_002265.2| ENSPTRP00000015614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]