SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13375789|ref|NP_078870.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13375789|ref|NP_078870.1|
Domain Number 1 Region: 130-150,181-366
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.89e-75
Family Fumble-like 0.000000016
Further Details:      
 
Domain Number 2 Region: 11-155
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.3e-44
Family Fumble-like 0.00000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13375789|ref|NP_078870.1|
Sequence length 370
Comment pantothenate kinase 3 [Homo sapiens]
Sequence
MKIKDAKKPSFPWFGMDIGGTLVKLSYFEPIDITAEEEQEEVESLKSIRKYLTSNVAYGS
TGIRDVHLELKDLTLFGRRGNLHFIRFPTQDLPTFIQMGRDKNFSTLQTVLCATGGGAYK
FEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNGQAECYYFANASEPERCQKMPFNLD
DPYPLLVVNIGSGVSILAVHSKDNYKRVTGTSLGGGTFLGLCSLLTGCESFEEALEMASK
GDSTQADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVSKEDLARATLVTITNN
IGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAV
GALLGLPNFS
Download sequence
Identical sequences A0A096NAL7 A0A0D9RCP7 A0A1U7TJ71 A0A2K5CPC8 A0A2K5H727 A0A2K5N0F8 A0A2K5SAT0 A0A2K5UTZ7 A0A2K5ZQZ9 A0A2K6DD44 A0A2K6LP23 A0A2K6R4S1 A0A2K6T3S5 F7FKC8 G1QYB8 G1T2E0 G3QQI1 H2PHB3 H2QRZ1 H9FZT4 Q9H999
GO.36773 ENSCJAP00000044183 ENSPTRP00000029910 9598.ENSPTRP00000029910 9600.ENSPPYP00000017936 9606.ENSP00000239231 ENSOCUP00000010314 ENSP00000239231 ENSPTRP00000029910 NP_078870.1.87134 NP_078870.1.92137 XP_002710244.1.1745 XP_002744198.1.60252 XP_002816212.1.23681 XP_003782009.1.62490 XP_003810962.1.60992 XP_004043011.1.27298 XP_008013448.1.81039 XP_008053027.1.4292 XP_010344966.1.74449 XP_010356493.1.97406 XP_011803139.1.43180 XP_011853295.1.47321 XP_012316529.1.9421 XP_012360545.1.23891 XP_012636423.1.48125 XP_014996862.1.72884 XP_017389947.1.71028 XP_017704894.1.44346 XP_518087.3.37143 ENSP00000239231 ENSPPYP00000017936 ENSP00000239231 ENSOCUP00000010314 ENSCJAP00000028648 ENSGGOP00000004847 ENSNLEP00000005939 gi|13375789|ref|NP_078870.1| ENSPPYP00000017936 ENSGGOP00000025550 ENSNLEP00000005939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]