SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13376842|ref|NP_079511.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13376842|ref|NP_079511.1|
Domain Number 1 Region: 335-469,496-634
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.32e-68
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 28-319
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.52e-66
Family Ankyrin repeat 0.0000259
Further Details:      
 
Domain Number 3 Region: 644-789
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.88e-40
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 953-1156
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.63e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0022
Further Details:      
 
Domain Number 5 Region: 874-935
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000334
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|13376842|ref|NP_079511.1|
Sequence length 1166
Comment tankyrase-2 [Homo sapiens]
Sequence
MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKST
PLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNAR
DNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDE
LLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAK
DKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYG
ADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKH
PQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVV
KHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQL
LQEGISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVS
VVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAA
AKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLAR
VKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAA
SYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQT
PLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASS
LDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQIT
LDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSP
DDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEEN
HNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTG
CPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYV
IYRGEQAYPEYLITYQIMRPEGMVDG
Download sequence
Identical sequences G3R2V0 H2Q295 Q9H2K2
gi|13376842|ref|NP_079511.1| ENSP00000360689 ENSP00000360689 ENSGGOP00000009562 ENSP00000360689 9606.ENSP00000360689 HR6526 NP_079511.1.87134 NP_079511.1.92137 XP_004049837.1.27298 XP_009457211.1.37143 ENSPTRP00000004801 ENSGGOP00000009562 ENSPTRP00000004801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]