SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|133925801|ref|NP_001076046.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|133925801|ref|NP_001076046.1|
Domain Number 1 Region: 88-193
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.64e-26
Family Canonical RBD 0.0000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|133925801|ref|NP_001076046.1|
Sequence length 370
Comment RNA binding protein fox-1 homolog 2 isoform 4 [Homo sapiens]
Sequence
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLT
LYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPF
RFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKI
EVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNDAAVPLSGR
GGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGV
DMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPTMPLPLPLAMELALWRVYTEVA
TADLPPTEVT
Download sequence
Identical sequences NP_001076046.1.87134 NP_001076046.1.92137 gi|133925801|ref|NP_001076046.1| ENSP00000407855 ENSP00000482053 ENSP00000407855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]