SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134031945|ref|NP_940857.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134031945|ref|NP_940857.2|
Domain Number 1 Region: 2064-2226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.04e-26
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 2552-2609
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000085
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 3 Region: 4001-4058
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000589
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 2826-2882
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000929
Family TSP-1 type 1 repeat 0.00051
Further Details:      
 
Domain Number 5 Region: 3253-3301
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 6 Region: 2715-2765
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000114
Family TSP-1 type 1 repeat 0.00084
Further Details:      
 
Domain Number 7 Region: 2982-3039
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000916
Family TSP-1 type 1 repeat 0.00057
Further Details:      
 
Domain Number 8 Region: 3642-3692
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.00057
Further Details:      
 
Domain Number 9 Region: 4252-4300
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 10 Region: 3807-3865
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000942
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 11 Region: 1561-1599
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 3944-4001
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 13 Region: 3471-3519
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00082
Further Details:      
 
Domain Number 14 Region: 1270-1333
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000249
Family ATI-like 0.033
Further Details:      
 
Domain Number 15 Region: 3087-3144
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000034
Family ATI-like 0.044
Further Details:      
 
Domain Number 16 Region: 1450-1487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 17 Region: 3404-3463
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000011
Family TSP-1 type 1 repeat 0.00049
Further Details:      
 
Domain Number 18 Region: 1374-1411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000114
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 2231-2269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 20 Region: 2462-2498
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 21 Region: 464-526
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000196
Family BSTI 0.056
Further Details:      
 
Domain Number 22 Region: 4763-4812
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 23 Region: 1491-1529
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 24 Region: 1415-1452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 25 Region: 2387-2426
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 26 Region: 1749-1802
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000615
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 27 Region: 822-882
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000942
Family ATI-like 0.042
Further Details:      
 
Domain Number 28 Region: 1810-1869
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000116
Family BSTI 0.041
Further Details:      
 
Domain Number 29 Region: 1694-1743
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 30 Region: 2499-2552
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 31 Region: 3184-3222
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 32 Region: 4817-4874
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000311
Family BSTI 0.025
Further Details:      
 
Domain Number 33 Region: 2945-3001
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000471
Family Fibronectin type I module 0.063
Further Details:      
 
Domain Number 34 Region: 4058-4117
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000589
Family BSTI 0.036
Further Details:      
 
Domain Number 35 Region: 2774-2822
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000641
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 36 Region: 2632-2677
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000801
Family ATI-like 0.023
Further Details:      
 
Domain Number 37 Region: 3880-3928
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000824
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 38 Region: 3042-3082
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 39 Region: 1602-1640
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 40 Region: 4156-4211
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000222
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 41 Region: 4976-5043
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000272
Family VWC domain 0.056
Further Details:      
 
Domain Number 42 Region: 1906-1964
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000471
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 43 Region: 4612-4664
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000484
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 44 Region: 3316-3365
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000491
Family BSTI 0.03
Further Details:      
 
Domain Number 45 Region: 4674-4725
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000523
Family ATI-like 0.044
Further Details:      
 
Domain Number 46 Region: 922-976
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000719
Family ATI-like 0.057
Further Details:      
 
Domain Number 47 Region: 2882-2947
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000785
Family ATI-like 0.097
Further Details:      
 
Domain Number 48 Region: 4422-4480
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000105
Family ATI-like 0.013
Further Details:      
 
Domain Number 49 Region: 4928-4986
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000126
Family ATI-like 0.025
Further Details:      
 
Domain Number 50 Region: 890-919
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0000186
Family PMP inhibitors 0.0024
Further Details:      
 
Domain Number 51 Region: 1655-1681
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000563
Family LDL receptor-like module 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|134031945|ref|NP_940857.2|
Domain Number - Region: 1962-2024
Classification Level Classification E-value
Superfamily FnI-like domain 0.000178
Family VWC domain 0.092
Further Details:      
 
Domain Number - Region: 4310-4362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000222
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number - Region: 3527-3587
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000278
Family ATI-like 0.083
Further Details:      
 
Domain Number - Region: 974-1015
Classification Level Classification E-value
Superfamily FnI-like domain 0.00045
Family VWC domain 0.063
Further Details:      
 
Domain Number - Region: 3696-3753
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00085
Family BSTI 0.062
Further Details:      
 
Domain Number - Region: 4209-4270
Classification Level Classification E-value
Superfamily FnI-like domain 0.00091
Family VWC domain 0.069
Further Details:      
 
Domain Number - Region: 4361-4418
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00222
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number - Region: 533-561
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00288
Family PMP inhibitors 0.003
Further Details:      
 
Domain Number - Region: 4128-4156
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0196
Family PMP inhibitors 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134031945|ref|NP_940857.2|
Sequence length 5147
Comment SCO-spondin precursor [Homo sapiens]
Sequence
MLLPALLFGMAWALADGRWCEWTETIRVEEEVAPRQEDLVPCASLDHYSRLGWRLDLPWS
GRSGLTRSPAPGLCPIYKPPETRPAKWNRTVRTCCPGWGGAHCTEALAKASPEGHCFAMW
QCQLQAGSANASAGSLEECCARPWGQSWWDGSSQACRSCSSRHLPGSASSPALLQPLAGA
VGQLWSQHQRPSATCASWSGFHYRTFDGRHYHFLGRCTYLLAGAADSTWAVHLTPGDRCP
QPGHCQRVTMGPEEVLIQAGNVSVKGQLVPEGQSWLLHGLSLQWLGDWLVLSGGLGVVVR
LDRTGSISISVDHELWGQTQGLCGLYNGWPEDDFMEPGGGLAMLAATFGNSWRLPGSESG
CLDAVEVAQGCDPLGLIDADVEPGHLRAEAQDVCHQLLEGPFGQCHAQVSPAEYHEACLF
AYCAGAMAGSGQEGRQQAVCATFASYVQACARRHIHIRWRKPGFCERLCPGGQLYSDCVS
LCPPSCEAVGQGEEESCREECVSGCECPRGLFWNGTLCVPAAHCPCYYCRQRYVPGDTVR
QLCNPCVCRDGRWHCAQALCPAECAVGGDGHYLTFDGRSYSFWGGQGCRYSLVQDYVKGQ
LLILLEHGACDAGSCLHAISVSLEDTHIQLRDSGAVLVNGQDVGLPWIGAEGLSVRRASS
AFLLLRWPGAQVLWGLSDPVAYITLDPRHAHQVQGLCGTFTQNQQDDFLTPAGDVETSIA
AFASKFQVAGKGRCPSEDSALLSPCTTHSQRHAFAEAACAILHSSVFQECHRLVDKEPFY
LRCLAAVCGCDPGSDCLCPVLSAYARRCAQEGASPPWRNQTLCPVMCPGGQEYRECAPAC
GQHCGKPEDCGELGSCVAGCNCPLGLLWDPEGQCVPPSLCPCQLGARRYAPGSATMKECN
RCICQERGLWNCTARHCPSQAFCPRELVYAPGACLLTCDSPSANHSCPAGSTDGCVCPPG
TVLLDERCVPPDLCPCRHSGQWYLPNATIQEDCNVCVCRGRQWHCTGQRRSGRCQASGAP
HYVTFDGLAFTYPGACEYLLVREASGLFTVSAQNLPCGASGLTCTKALAVRLEGTVVHML
RGRAVTVNGVSVTPPKVYTGPGLSLRRAGLFLLLSTHLGLTLLWDGGTRVLVQLSPQFRG
RVAGLCGDFDGDASNDLRSRQGVLEPTAELAAHSWRLSPLCPEPGDLPHPCTMNTHRAGW
ARARCGALLQPLFTLCHAEVPPQQHYEWCLYDACGCDSGGDCECLCSAIATYADECARHG
HHVRWRSQELCSLQCEGGQVYEACGPTCPPTCHEQHPEPGWHCQVVACVEGCFCPEGTLL
HGGACLEPASCPCEWGRNSFPPGSVLQKDCGNCTCQEGQWHCGGDGGHCEELVPACAEGE
ALCQENGHCVPHGWLCDNQDDCGDGSDEEGCAAPGCGEGQMTCSSGHCLPLALLCDRQDD
CGDGTDEPSYPCPQGLLACADGRCLPPALLCDGHPDCLDAADEESCLGQVTCVPGEVSCV
DGTCLGAIQLCDGVWDCPDGADEGPGHCPLPSLPTPPASTLPGPSPGSLDTASSPLASAS
PAPPCGPFEFRCGSGECTPRGWRCDQEEDCADGSDERGCGGPCAPHHAPCARGPHCVSPE
QLCDGVRQCPDGSDEGPDACGGLPALGGPNRTGLPCPEYTCPNGTCIGFQLVCDGQPDCG
RPGQVGPSPEEQGCGAWGPWSPWGPCSRTCGPWGQGRSRRCSPLGLLVLQNCPGPEHQSQ
ACFTAACPVDGEWSTWSPWSVCSEPCRGTMTRQRQCHSPQNGGRTCAALPGGLHSTRQTK
PCPQDGCPNATCSGELMFQPCAPCPLTCDDISGQVTCPPDWPCGSPGCWCPEGQVLGSEG
WCVWPRQCPCLVDGARYWPGQRIKADCQLCICQDGRPRRCRLNPDCAVDCGWSSWSPWAK
CLGPCGSQSIQWSFRSSNNPRPSGRGRQCRGIHRKARRCQTEPCEGCEHQGQVHRVGERW
HGGPCRVCQCLHNLTAHCSPYCPLGSCPQGWVLVEGTGESCCHCALPGENQTVQPMATPA
AAPAPSPQIRFPLATYILPPSGDPCYSPLGLAGLAEGSLHASSQQLEHPTQAALLGAPTQ
GPSPQGWHAGGDAYAKWHTRPHYLQLDLLQPRNLTGILVPETGSSNAYASSFSLQFSSNG
LHWHDYRDLLPGILPLPKLFPRNWDDLDPAVWTFGRMVQARFVRVWPHDVHHSDVPLQVE
LLGCEPGSPPAPLCPGVGLRCASGECVLRGGPCDGVLDCEDGSDEEGCVLLPEGTGRFHS
TAKTLALSSAQPGQLLHWPREGLAETEHWPPGQESPTSPTETRPVSPGPASGVPHHGESV
QMVTTTPIPQMEARTLPPGMAAVTVVPPHPVTPATPAGQSVAPGPFPPVQCGPGQTPCEV
LGCVEQAQVCDGREDCLDGSDERHCARNLLMWLPSLPALWAASTVPFMMPTMALPGLPAS
RALCSPSQLSCGSGECLSAERRCDLRPDCQDGSDEDGCVDCVLAPWSVWSSCSRSCGLGL
TFQRQELLRPPLPGGSCPRDRFRSQSCFVQACPVAGAWAMWEAWGPCSVSCGGGHQSRQR
SCVDPPPKNGGAPCPGASQERAPCGLQPCSGGTDCELGRVYVSADLCQKGLVPPCPPSCL
DPKANRSCSGHCVEGCRCPPGLLLHDTRCLPLSECPCLVGEELKWPGVSFLLGNCSQCVC
EKGELLCQPGGCPLPCGWSAWSSWAPCDRSCGSGVRARFRSPSNPPAAWGGAPCEGDRQE
LQGCHTVCGTEVFGWTPWTSWSSCSQSCLAPGGGPGWRSRSRLCPSPGDSSCPGDATQEE
PCSPPVCPVPSIWGLWAPWSTCSAPCDGGIQTRGRSCSSLAPGDTTCPGPHSQTRDCNTQ
PCTAQCPENMLFRSAEQCHQEGGPCPRLCLTQGPGIECTGFCAPGCTCPPGLFLHNASCL
PRSQCPCQLHGQLYASGAMARLDSCNNCTCVSGKMACTSERCPVACGWSPWTLWSLCSCS
CNVGIRRRFRAGTAPPAAFGGAECQGPTMEAEFCSLRPCPGPGGEWGPWSPCSVPCGGGY
RNRTRGSSRSLMEFSTCGLQPCAGPVPGMCPRDKQWLDCAQGPASCAELSAPRGTNQTCH
PGCHCPSGMLLLNNVCVPTQDCPCAHEGHLYPPGSTVVRPCENCSCVSGLIANCSSWPCA
EGEPTWSPWTPWSQCSASCGPARCHRHRFCARSPSAVPSTVAPLPLPATPTPLCSGPEAE
EEPCLLQGCDRAGGWGPWGPWSHCSRSCGGGLRSRTRACDQPPPQGLGDYCEGPRAQGEV
CQALPCPVTNCTAIEGAEYSPCGPPCPRSCDDLVHCVWRCQPGCYCPPGQVLSSNGAICV
QPGHCSCLDLLTGQRHHPGARLARPDGCNHCTCLEGRLNCTDLPCPVPGGWCPWSEWTMC
SQPCRGQTRSRSRACACPTPQHGGAPCTGEAGEAGAQHQREACPSYATCPVDGAWGPWGP
WSPCDMCLGQSHRSRACSRPPTPEGGRPCPGNHTQSRPCQENSTQCTDCGGGQSLHPCGQ
PCPRSCQDLSPGSVCQPGSVGCQPTCGCPLGQLSQDGLCVPPAHCRCQYQPGAMGIPENQ
SRSAGSRFSSWESLEPGEVVTGPCDNCTCVAGILQCQEVPDCPDPGVWSSWGPWEDCSVS
CGGGEQLRSRRCARPPCPGPARQSRTCSTQVCREAGCPAGRLYRECQPGEGCPFSCAHVT
QQVGCFSEGCEEGCHCPEGTFQHRLACVQECPCVLTAWLLQELGATIGDPGQPLGPGDEL
DSGQTLRTSCGNCSCAHGKLSCSLDDCFEADGGFGPWSPWGPCSRSCGGLGTRTRSRQCV
LTMPTLSGQGCRGPRQDLECPSPDCPGAEGSTVEPVTGLPGGWGPWSSWSPCSRSCTDPA
RPAWRSRTRLCLANCTMGDPLQERPCNLPSCTELPVCPGPGCGAGNCSWTSWAPWEPCSR
SCGVGQQRRLRAYRPPGPGGHWCPNILTAYQERRFCNLRACPVPGGWSRWSPWSWCDRSC
GGGQSLRSRSCSSPPSKNGGAPCAGERHQARLCNPMPCEAGCPAGMEVVTCANRCPRRCS
DLQEGIVCQDDQVCQKGCRCPKGSLEQDGGCVPIGHCDCTDAQGHSWAPGSQHQDACNNC
SCQAGQLSCTAQPCPPPTHCAWSHWSAWSPCSHSCGPRGQQSRFRSSTSGSWAPECREEQ
SQSQPCPQPSCPPLCLQGTRSRTLGDSWLQGECQRCSCTPEGVICEDTECAVPEAWTLWS
SWSDCPVSCGGGNQVRTRACRAAAPHHRSPPCLGPDTQTRQQPCPGLLEACSWGPWGPCS
RSCGPGLASRSGSCPCLMAKADPTCNSTFLHLDTQGCYSGPCPEECVWSSWSSWTRCSCR
VLVQQRYRHQGPASRGARAGAPCTRLDGHFRPCLISNCSEDSCTPPFEFHACGSPCAGLC
ATHLSHQLCQDLPPCQPGCYCPKGLLEQAGGCIPPEECNCWHTSAAGAGMTLAPGDRLQL
GCKECECRRGELHCTSQGCQGLLPLSEWSEWSPCGPCLPPSALAPASRTALEEHWLRDPT
GLSPTLAPLLASEQHRHRLCLDPATGRPWTGAPHLCTAPLSQQRLCPDPGACPDSCQWSL
WGPWSPCQVPCSGGFRLRWREAEALCGGGCREPWAQESCNGGPCPECEAQDTVFTLDCAN
QCPHSCADLWDRVQCLQGPCRPGCRCPPGQLVQDGRCVPISSCRCGLPSANASWELAPAQ
AVQLDCQNCTCVNESLVCPHQECPVLGPWSAWSSCSAPCGGGTMERHRTCEGGPGVAPCQ
AQDTEQRQECNLQPCPECPPGQVLSACATSCPCLCWHLQPGAICVQEPCQPGCGCPGGQL
LHNGTCVPPTACPCTQHSLPWGLTLTLEEQAQELPPGTVLTRNCTRCVCHGGAFSCSLVD
CQVPPGETWQQVAPGELGLCEQTCLEMNATKTQSNCSSARASGCVCQPGHFRSQAGPCVP
EDHCECWHLGRPHLPGSEWQEACESCLCLSGRPVCTQHCSPLTCAQGEEMVLEPGSCCPS
CRREAPEEQSPSCQLLTELRNFTKGTCYLDQVEVSYCSGYCPSSTHVMPEEPYLQSQCDC
CSYRLDPESPVRILNLRCLGGHTEPVVLPVIHSCQCSSCQGGDFSKR
Download sequence
Identical sequences gi|134031945|ref|NP_940857.2| NP_940857.2.87134 NP_940857.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]