SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13676857|ref|NP_068814.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13676857|ref|NP_068814.2|
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.56e-72
Family Actin/HSP70 0.0000000307
Further Details:      
 
Domain Number 2 Region: 194-385
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.07e-69
Family Actin/HSP70 0.0000000229
Further Details:      
 
Domain Number 3 Region: 389-546
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 2.22e-66
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0000000899
Further Details:      
 
Domain Number 4 Region: 541-621
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 2.49e-31
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13676857|ref|NP_068814.2|
Sequence length 639
Comment heat shock-related 70 kDa protein 2 [Homo sapiens]
Sequence
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI
SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD
Download sequence
Identical sequences A0A024R6B5 A0A0D9SDX8 G7MYA4 G7PAI9 P54652
9606.ENSP00000247207 ENSP00000247207 gi|13676857|ref|NP_068814.2| ENSP00000247207 ENSP00000378199 NP_068814.2.87134 NP_068814.2.92137 XP_005561533.1.63531 XP_007985157.1.81039 XP_010382001.1.97406 XP_011725927.1.29376 XP_011805161.1.43180 XP_011909178.1.92194 XP_014999373.1.72884 ENSP00000247207 ENSP00000378199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]