SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13899255|ref|NP_113621.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13899255|ref|NP_113621.1|
Domain Number 1 Region: 300-414
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-35
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 2 Region: 144-252
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-33
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 3 Region: 464-577
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-28
Family Frizzled cysteine-rich domain 0.00032
Further Details:      
 
Domain Number 4 Region: 258-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 419-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000124
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13899255|ref|NP_113621.1|
Sequence length 579
Comment membrane frizzled-related protein [Homo sapiens]
Sequence
MKDFSDVILCMEATESSKTEFCNPAFEPESGPPCPPPVFPEDASYSVPAPWHGRRPRGLR
PDCRFSWLCVLLLSSLLLLLLGLLVAIILAQLQAAPPSGASHSPLPAGGLTTTTTTPTIT
TSQAAGTPKGQQESGVSPSPQSTCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDH
AIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNASHLLVVFVSDSS
VEGFGFHAWYQAMAPGRGSCAHDEFRCDQLICLLPDSVCDGFANCADGSDETNCSAKFSG
CGGNLTGLQGTFSTPSYLQQYPHQLLCTWHISVPAGHSIELQFHNFSLEAQDECKFDYVE
VYETSSSGAFSLLGRFCGAEPPPHLVSSHHELAVLFRTDHGISSGGFSATYLAFNATENP
CGPSELSCQAGGCKGVQWMCDMWRDCTDGSDDNCSGPLFPPPELACEPVQVEMCLGLSYN
TTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRS
VCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP
Download sequence
Identical sequences Q9BY79
ENSP00000391664 ENSP00000450509 ENSP00000456533 ENSP00000391664 ENSP00000456533 ENSP00000481824 gi|13899255|ref|NP_113621.1| ENSP00000353291 ENSP00000456533 9606.ENSP00000391664 NP_113621.1.87134 NP_113621.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]