SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13899267|ref|NP_113626.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13899267|ref|NP_113626.1|
Domain Number 1 Region: 264-456
Classification Level Classification E-value
Superfamily Nudix 1.62e-45
Family NADH pyrophosphatase 0.0011
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.29e-20
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|13899267|ref|NP_113626.1|
Sequence length 462
Comment peroxisomal NADH pyrophosphatase NUDT12 [Homo sapiens]
Sequence
MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPE
IVQFLLEKGCDRSIVNKSRQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENY
FSKTLLDRKSEKRNNSDWLLAKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLN
YTDIKDYLAQPEKITLIFLGVELEIKDKLLNYAGEVPREEEDGLVAWFALGIDPIAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKR
LCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDAR
WFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPNL
Download sequence
Identical sequences Q9BQG2
400085 hss001003980.1 NP_113626.1.87134 NP_113626.1.92137 XP_005272152.1.92137 ENSP00000230792 ENSP00000230792 gi|13899267|ref|NP_113626.1| 9606.ENSP00000230792 ENSP00000230792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]