SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13994259|ref|NP_114108.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13994259|ref|NP_114108.1|
Domain Number 1 Region: 175-376
Classification Level Classification E-value
Superfamily PDB 7.17e-74
Family PDB 0.00034
Further Details:      
 
Domain Number 2 Region: 288-367
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-20
Family Translational machinery components 0.0038
Further Details:      
 
Domain Number 3 Region: 214-285
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000000305
Family Ribosomal S5 protein, N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13994259|ref|NP_114108.1|
Sequence length 430
Comment 28S ribosomal protein S5, mitochondrial [Homo sapiens]
Sequence
MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPY
ASLSRALQTQCCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKK
KKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWD
RKKKMKVKRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKS
IRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHDISLRFKR
THIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLFRGLSRQETHQ
QLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRS
VWSNLKRAAT
Download sequence
Identical sequences P82675
gi|13994259|ref|NP_114108.1| ENSP00000272418 ENSP00000272418 NP_114108.1.87134 NP_114108.1.92137 3j9m_AD ENSP00000272418 9606.ENSP00000272418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]